Leucine aminopeptidase from Aquifex aeolicus

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 493 amino acids
MKEMEVRAFKDDIKKYKGKSVAVFVYEGDLKPLARLSKGTSNKAKRVAELENFKGKEGEILKVPTLGTSVDFVYIVGLGKKEKVGEDTYRRASANLVKRMRRDKVESTVVVIPRRGDVSKEITKAITEGAILGNYRFDKYKSKKEDEKFEIKEVLINRGDEEGIRLGKIFAEAQNYARNLVNEPGNVINPITLAEEAKKLAEEFGLECKVYDEKQIQEMGMMALYSVGKGSATPPRFIHLIYKPSGKPKEKIALVGKGLTFDSGGLNIKPGDYMRTMKMDKSGACAVLGIMRAIAQLKPDVEVHGLIGAAENMPDGNAYRPDDVIKAKNGKYIEIDNTDAEGRVTLADVLSYASELKPDKIIDMATLTGACMVALGEYTAGLFTNAPDFAEEIKKTAKRTGERVWELPMDDERLRKKIKNTVADVLNTGGRYGGAITAAMFLEEFVGEGIKWVHLDIAGPAWSKEEYGYYTKGGTGFGVRTCLEYIMKVSSNV
Anisur Rahman Khan et al. (2000) β€” Characterization of a solvent resistant and thermostable aminopeptidase from the hyperthermophillic bacterium, Aquifex aeolicus
Enzyme and Microbial Technology  Β· doi:10.1016/s0141-0229(00)00194-0 β†—  Β· Activity - Classical Activity - Michaelis-Menten
69 measurements
Database ID
UniProt: O67868 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (69 measurements)

69 measurements β€” page 1 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 20% 100.0 26.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 5% 100.0 77.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 10% 100.0 62.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 20% 100.0 35.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 30% 100.0 24.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 40% 100.0 15.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethylformamide (DMF) 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 100.0 72.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 55.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 100.0 34.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100.0 20.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40% 100.0 16.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 5% 100.0 71.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 10% 100.0 48.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100.0 100.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 30% 100.0 13.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 40% 100.0 6.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1,4-Dioxane 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*