Leucine aminopeptidase from Aquifex aeolicus

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 493 amino acids
MKEMEVRAFKDDIKKYKGKSVAVFVYEGDLKPLARLSKGTSNKAKRVAELENFKGKEGEILKVPTLGTSVDFVYIVGLGKKEKVGEDTYRRASANLVKRMRRDKVESTVVVIPRRGDVSKEITKAITEGAILGNYRFDKYKSKKEDEKFEIKEVLINRGDEEGIRLGKIFAEAQNYARNLVNEPGNVINPITLAEEAKKLAEEFGLECKVYDEKQIQEMGMMALYSVGKGSATPPRFIHLIYKPSGKPKEKIALVGKGLTFDSGGLNIKPGDYMRTMKMDKSGACAVLGIMRAIAQLKPDVEVHGLIGAAENMPDGNAYRPDDVIKAKNGKYIEIDNTDAEGRVTLADVLSYASELKPDKIIDMATLTGACMVALGEYTAGLFTNAPDFAEEIKKTAKRTGERVWELPMDDERLRKKIKNTVADVLNTGGRYGGAITAAMFLEEFVGEGIKWVHLDIAGPAWSKEEYGYYTKGGTGFGVRTCLEYIMKVSSNV
Anisur Rahman Khan et al. (2000) β€” Characterization of a solvent resistant and thermostable aminopeptidase from the hyperthermophillic bacterium, Aquifex aeolicus
Enzyme and Microbial Technology  Β· doi:10.1016/s0141-0229(00)00194-0 β†—  Β· Activity - Classical Activity - Michaelis-Menten
69 measurements
Database ID
UniProt: O67868 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (69 measurements)

69 measurements β€” page 3 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 80% 100.0 8.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 5% 100.0 91.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100.0 73.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 20% 100.0 59.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100.0 46.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 40% 100.0 28.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 50% 100.0 5.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 5% 100.0 58.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 20% 100.0 19.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 40% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 20% 100.0 13.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 10% 100.0 54.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 5% 100.0 65.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 40% 100.0 12.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30% 100.0 28.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 20% 100.0 51.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 100.0 86.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 5% 100.0 96.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*