Leucine aminopeptidase from Aquifex aeolicus

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 493 amino acids
MKEMEVRAFKDDIKKYKGKSVAVFVYEGDLKPLARLSKGTSNKAKRVAELENFKGKEGEILKVPTLGTSVDFVYIVGLGKKEKVGEDTYRRASANLVKRMRRDKVESTVVVIPRRGDVSKEITKAITEGAILGNYRFDKYKSKKEDEKFEIKEVLINRGDEEGIRLGKIFAEAQNYARNLVNEPGNVINPITLAEEAKKLAEEFGLECKVYDEKQIQEMGMMALYSVGKGSATPPRFIHLIYKPSGKPKEKIALVGKGLTFDSGGLNIKPGDYMRTMKMDKSGACAVLGIMRAIAQLKPDVEVHGLIGAAENMPDGNAYRPDDVIKAKNGKYIEIDNTDAEGRVTLADVLSYASELKPDKIIDMATLTGACMVALGEYTAGLFTNAPDFAEEIKKTAKRTGERVWELPMDDERLRKKIKNTVADVLNTGGRYGGAITAAMFLEEFVGEGIKWVHLDIAGPAWSKEEYGYYTKGGTGFGVRTCLEYIMKVSSNV
Anisur Rahman Khan et al. (2000) β€” Characterization of a solvent resistant and thermostable aminopeptidase from the hyperthermophillic bacterium, Aquifex aeolicus
Enzyme and Microbial Technology  Β· doi:10.1016/s0141-0229(00)00194-0 β†—  Β· Activity - Classical Activity - Michaelis-Menten
69 measurements
Database ID
UniProt: O67868 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (69 measurements)

69 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 40% 100.0 7.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100.0 11.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Acetone 10% 100.0 36.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 1.2 5.0 mM 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 40% 1.2 8.0 mM 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 60% 1.2 9.0 mM 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 0.7 1.0 1/s 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 40% 0.7 0.5 1/s 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 60% 0.7 0.3 1/s 50 mM Tris-HCl 8 45Β°C Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in 1/s)
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*