Leucine aminopeptidase from Aquifex aeolicus

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 493 amino acids
MKEMEVRAFKDDIKKYKGKSVAVFVYEGDLKPLARLSKGTSNKAKRVAELENFKGKEGEILKVPTLGTSVDFVYIVGLGKKEKVGEDTYRRASANLVKRMRRDKVESTVVVIPRRGDVSKEITKAITEGAILGNYRFDKYKSKKEDEKFEIKEVLINRGDEEGIRLGKIFAEAQNYARNLVNEPGNVINPITLAEEAKKLAEEFGLECKVYDEKQIQEMGMMALYSVGKGSATPPRFIHLIYKPSGKPKEKIALVGKGLTFDSGGLNIKPGDYMRTMKMDKSGACAVLGIMRAIAQLKPDVEVHGLIGAAENMPDGNAYRPDDVIKAKNGKYIEIDNTDAEGRVTLADVLSYASELKPDKIIDMATLTGACMVALGEYTAGLFTNAPDFAEEIKKTAKRTGERVWELPMDDERLRKKIKNTVADVLNTGGRYGGAITAAMFLEEFVGEGIKWVHLDIAGPAWSKEEYGYYTKGGTGFGVRTCLEYIMKVSSNV
Anisur Rahman Khan et al. (2000) β€” Characterization of a solvent resistant and thermostable aminopeptidase from the hyperthermophillic bacterium, Aquifex aeolicus
Enzyme and Microbial Technology  Β· doi:10.1016/s0141-0229(00)00194-0 β†—  Β· Activity - Classical Activity - Michaelis-Menten
69 measurements
Database ID
UniProt: O67868 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (69 measurements)

69 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 5% 100.0 62.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 10% 100.0 61.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 20% 100.0 35.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 30% 100.0 16.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 40% 100.0 3.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 5% 100.0 55.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 10% 100.0 51.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 20% 100.0 20.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 30% 100.0 6.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 40% 100.0 1.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent 1-Propanol 50% 100.0 0.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Tetrahydrofuran (THF) 30% 100.0 9.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 5% 100.0 100.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 20% 100.0 100.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100.0 100.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 40% 100.0 62.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 50% 100.0 47.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 60% 100.0 29.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurement, 405 nm) in the presence of organic solvent Methanol 70% 100.0 16.0 % 50 mM Tris-HCl 8 45Β°C ? mM Leucine p-nitroanilide L-Leucine , p-Nitroaniline β€” β€” Classical aqueous control (in %)
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*