Esterase BSE01701 from Bacillus sp. SCSIO 15121

Enzyme Description

Species
Bacillus sp. SCSIO 15121 β†—
Extremophile
No
EC Number
3.1.1.1 β†—

Sequence

Length: 255 amino acids
MIQIENQAVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLLAEKGFRAVLPEALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFEKEGLVDGGRIGLAGTSMGGITTLGALTAYDWIKAGVSLMGSPNYVELFQQQIDHIQSQGIDIDVPEEKVQQLMKRLELRDLSLQPEKLQQRPLLFWHGAKDKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVPRAAVLKTIEWFETYL
Jinlong Huang et al. (2016) β€” Functional Characterization of a Marine Bacillus Esterase and its Utilization in the Stereo-Selective Production of D-Methyl Lactate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2180-y β†—  Β· Stability - Incubation Specificity - Enantioselectivity Activity + StabilityΒ - Conversion
54 measurements ▼
Database ID
UniParc: UPI00059DAC50 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (54 measurements)

54 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 20% 49.77 78.19 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 30% 49.77 89.15 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 40% 49.77 93.05 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 50% 49.77 96.69 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 60% 49.77 98.19 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 70% 49.77 90.49 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 80% 49.77 50.83 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Specificity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Hexane 5% 77.73 86.25 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Heptane 5% 100.0 98.56 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 5% 100.0 111.2 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Decane 5% 100.0 89.54 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 5% 100.0 106.49 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Propanol 5% 100.0 99.44 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Octanol 5% 100.0 78.54 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 5% 100.0 101.24 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Tetrahydrofuran (THF) 5% 100.0 66.48 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1,4-Dioxane 5% 100.0 39.55 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Toluene 5% 100.0 53.55 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 5% 100.0 55.65 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 5% 100.0 103.89 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
β€Ή Prev
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity β€” Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + StabilityΒ - Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*