Esterase BSE01701 from Bacillus sp. SCSIO 15121

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 255 amino acids
MIQIENQAVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLLAEKGFRAVLPEALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFEKEGLVDGGRIGLAGTSMGGITTLGALTAYDWIKAGVSLMGSPNYVELFQQQIDHIQSQGIDIDVPEEKVQQLMKRLELRDLSLQPEKLQQRPLLFWHGAKDKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVPRAAVLKTIEWFETYL
Jinlong Huang et al. (2016) β€” Functional Characterization of a Marine Bacillus Esterase and its Utilization in the Stereo-Selective Production of D-Methyl Lactate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2180-y β†—  Β· Stability - Incubation Activity + StabilityΒ - Conversion Selectivity - Enantioselectivity
54 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (54 measurements)

54 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 80% 38.25 41.4 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 62.0 61.41 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent Acetone 5% 62.0 54.9 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent 1-Propanol 5% 62.0 52.9 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Decane 5% 62.0 62.21 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 5% 62.0 66.22 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Hexane 5% 62.0 63.76 % 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 10% 38.25 51.66 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 20% 38.25 54.35 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 30% 38.25 57.12 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 40% 38.25 58.91 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 50% 38.25 60.19 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 60% 38.25 60.99 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Activity + StabilityΒ - Conversion Conversion (in %) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 70% 38.25 56.74 % 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 5% 77.73 91.88 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent 1-Propanol 5% 77.73 58.37 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5% 77.73 78.69 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent Acetone 5% 77.73 60.49 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Decane 5% 77.73 87.39 % enantiomeric excess 100 mM Tris-HCl buffer, 0.12 mg/mL enzyme concentration 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
Selectivity - Enantioselectivity Enantiomeric excess (toward s) after 30 minutes incubation at 35Β°C, determined by chiral GC in the presence of organic solvent n-Heptane 10% 49.77 71.05 % enantiomeric excess 100 mM Tris-HCl buffer, 0.064 mg/mL enzyme concentraton 9 35Β°C 50 mM Methyl lactate Lactic acid , Methanol β€” 200 rpm Classical aqueous control (in % enantiomeric excess)
β€Ή Prev
1 2 3

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + StabilityΒ - Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*