Esterase BSE01701 from Bacillus sp. SCSIO 15121

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 255 amino acids
MIQIENQAVSGIPFLHIVKEENRHRAVPLVIFIHGFTSAKEHNLHIAYLLAEKGFRAVLPEALHHGERGEEMAVEELAGHFWDIVLNEIEEIGVLKNHFEKEGLVDGGRIGLAGTSMGGITTLGALTAYDWIKAGVSLMGSPNYVELFQQQIDHIQSQGIDIDVPEEKVQQLMKRLELRDLSLQPEKLQQRPLLFWHGAKDKVVPYAPTRKFYDTIKSHYSEQPERLQFIGDENADHKVPRAAVLKTIEWFETYL
Jinlong Huang et al. (2016) β€” Functional Characterization of a Marine Bacillus Esterase and its Utilization in the Stereo-Selective Production of D-Methyl Lactate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2180-y β†—  Β· Stability - Incubation Activity + StabilityΒ - Conversion Selectivity - Enantioselectivity
54 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (54 measurements)

54 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dichloromethane 5% 100.0 26.39 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10% 100.0 97.51 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Heptane 10% 100.0 110.39 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Decane 10% 100.0 67.43 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100.0 72.32 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Propanol 10% 100.0 6.48 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Octanol 10% 100.0 10.31 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100.0 100.41 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Tetrahydrofuran (THF) 10% 100.0 4.15 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1,4-Dioxane 10% 100.0 4.28 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Toluene 10% 100.0 37.79 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Xylene 10% 100.0 56.12 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 10% 100.0 54.82 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 35Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dichloromethane 10% 100.0 40.0 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8.5, Assay: 8.5 Incubation: 35Β°C, Assay: 35Β°C 0.2 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + StabilityΒ - Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*