Lipase (gene lip9) from Pseudomonas aeruginosa LST-03

Enzyme Description

Species
Pseudomonas aeruginosa LST-03 β†—
Extremophile
No
EC Number
3.1.1.3 β†—

Sequence

Length: 311 amino acids
MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAILSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Hiroyasu Ogino et al. (2000) β€” Purification and characterization of organic solvent-stable lipase from organic solvent-tolerant Pseudomonas aeruginosa LST-03
Journal of Bioscience and Bioengineering  Β· doi:10.1016/s1389-1723(00)89095-7 β†—  Β· Activity - Classical Stability - Half-life
43 measurements ▼
Database ID
UniProt: A8QYB2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa LST-03

Experimental Data (43 measurements)

43 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent n-Octane 50% 1.0 1.01 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Chloroform 50% 1.0 0.1 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Hexanol 50% 1.0 0.11 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Pentanol 50% 1.0 0.12 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Heptanol 50% 1.0 0.13 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Decanol 50% 1.0 0.14 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Octanol 50% 1.0 0.15 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent 1-Butanol 50% 1.0 0.16 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Benzene 50% 1.0 0.19 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Ethanol 50% 1.0 0.21 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Toluene 50% 1.0 0.23 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Methanol 50% 1.0 0.25 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Isopropanol 50% 1.0 0.28 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent p-Xylene 50% 1.0 0.46 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Acetone 50% 1.0 0.35 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent n-Decane 50% 1.0 1.1 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 1.0 0.99 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent Dimethylformamide (DMF) 50% 1.0 0.92 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent n-Heptane 50% 1.0 0.84 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
Activity - Classical Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent n-Dodecane 50% 1.0 0.73 relative units 50 mM McIlvain buffer 7 30Β°C 2g/20 ml (including organic solvent) Tributyrin Butyric Acid , glycerol β€” 700 rpm Classical aqueous control (in relative units)
β€Ή Prev
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*