Lipase (gene lip9) from Pseudomonas aeruginosa LST-03
Enzyme Description
Sequence
MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAILSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Hiroyasu Ogino et al. (2000)
β Purification and characterization of organic solvent-stable lipase from organic solvent-tolerant Pseudomonas aeruginosa LST-03
Journal of Bioscience and Bioengineering
Β· doi:10.1016/s1389-1723(00)89095-7 β
Β· Activity - Classical Stability - Half-life
▼
Database ID
UniProt: A8QYB2 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa LST-03
Experimental Data (43 measurements)
43 measurements β page 2 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent | Cyclohexane | 50% | 1.0 | 0.71 | relative units | 50 mM McIlvain buffer | 7 | 30Β°C | 2g/20 ml (including organic solvent) Tributyrin | Butyric Acid , glycerol | β | 700 rpm | Classical aqueous control (in relative units) |
| Activity - Classical | Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent | Isooctane | 50% | 1.0 | 0.65 | relative units | 50 mM McIlvain buffer | 7 | 30Β°C | 2g/20 ml (including organic solvent) Tributyrin | Butyric Acid , glycerol | β | 700 rpm | Classical aqueous control (in relative units) |
| Activity - Classical | Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent | n-Hexane | 50% | 1.0 | 0.57 | relative units | 50 mM McIlvain buffer | 7 | 30Β°C | 2g/20 ml (including organic solvent) Tributyrin | Butyric Acid , glycerol | β | 700 rpm | Classical aqueous control (in relative units) |
| Activity - Classical | Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent | n-Hexadecane | 50% | 1.0 | 0.57 | relative units | 50 mM McIlvain buffer | 7 | 30Β°C | 2g/20 ml (including organic solvent) Tributyrin | Butyric Acid , glycerol | β | 700 rpm | Classical aqueous control (in relative units) |
| Activity - Classical | Relative activity, measured by pH-metry (free fatty acid titration with NaOH) in the presence of organic solvent | n-Tetradecane | 50% | 1.0 | 0.47 | relative units | 50 mM McIlvain buffer | 7 | 30Β°C | 2g/20 ml (including organic solvent) Tributyrin | Butyric Acid , glycerol | β | 700 rpm | Classical aqueous control (in relative units) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | tert-Butanol | 25% | 12.5 | 1.2 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | 1,5-Pentanediol | 25% | 12.5 | 6.8 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Ethanol | 25% | 12.5 | 7.6 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Triethylene Glycol | 25% | 12.5 | 7.7 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | p-Xylene | 25% | 12.5 | 8.3 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Toluene | 25% | 12.5 | 9.0 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | 1,4-Butanediol | 25% | 12.5 | 9.3 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Dimethylformamide (DMF) | 25% | 12.5 | 9.5 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Glycerol | 25% | 12.5 | 10.8 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Methanol | 25% | 12.5 | 11.3 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | n-Hexane | 25% | 12.5 | 11.6 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Cyclohexane | 25% | 12.5 | 15.7 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | Isooctane | 25% | 12.5 | 16.4 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | n-Heptane | 25% | 12.5 | 17.7 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) | n-Octane | 25% | 12.5 | 29.0 | days | Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 2 mM Dimercaptopropan-1-ol tributyrate | Butyric Acid , Free thiols | β | Incubation: 160 rpm | Classical aqueous control (in days) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Half-life
One bar per measurement. Colour = solvent, shade = solvent volume.