Recombinant protease from Oceanobacillus iheyensis

Enzyme Description

Extremophile
Yes "haloalkaliphilic" organism
EC Number

Sequence

Length: 135 amino acids
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022) β€” Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research  Β· doi:10.1007/s11356-022-21411-7 β†—  Β· Activity - Classical Stability - Incubation
42 measurements
Database ID
UniProt: E3UEQ6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (42 measurements)

42 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 10% 100.0 15.7 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 30% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 20% 100.0 23.9 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 10% 100.0 46.4 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 5% 100.0 60.4 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 30% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 20% 100.0 43.6 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 10% 100.0 54.8 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 5% 100.0 65.1 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 30% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 20% 100.0 6.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 10% 100.0 10.2 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Acetone 30% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 5% 100.0 29.9 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 5% 100.0 38.3 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 20% 100.0 8.4 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 30% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 5% 100.0 30.7 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 10% 100.0 11.8 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 20% 100.0 0.0 % 20 mM NaOH Borax buffer 10 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*