Recombinant protease from Oceanobacillus iheyensis

Enzyme Description

Species

Oceanobacillus iheyensis ↗

Extremophile

Yes "haloalkaliphilic" organism

EC Number

3.4.- ↗

Sequence

Length: 135 amino acids

MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR

Megha K. Purohit et al. (2022) — Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents

Environmental Science and Pollution Research · doi:10.1007/s11356-022-21411-7 ↗ · Activity - Classical Stability - Incubation

42 measurements ▼

Database ID

UniProt: E3UEQ6 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host bacterium Escherichia coli

Experimental Data (42 measurements)

42 measurements — page 2 of 3

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Glycerol	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	5%	100.0	28.6	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	10%	100.0	9.7	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	20%	100.0	3.4	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids , Peptides	—	—	Classical aqueous control (in %)
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	29.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	15.5	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	28.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	38.5	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	29.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	31.9	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	50.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	36.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	40.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	54.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	49.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	67.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	61.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	50.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	70.4	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	70.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids , Peptides	—	—	Non-incubated control (in %), assay in aqueous phase

Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Methanol	10%	100.0	15.7	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Xylene	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Xylene	20%	100.0	23.9	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Xylene	10%	100.0	46.4	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Xylene	5%	100.0	60.4	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	n-Hexane	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	n-Hexane	20%	100.0	43.6	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	n-Hexane	10%	100.0	54.8	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	n-Hexane	5%	100.0	65.1	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Chloroform	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Chloroform	20%	100.0	6.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Chloroform	10%	100.0	10.2	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Chloroform	5%	100.0	29.9	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Methanol	5%	100.0	38.3	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Methanol	20%	100.0	8.4	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Methanol	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Glycerol	5%	100.0	30.7	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Glycerol	10%	100.0	11.8	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Glycerol	20%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Glycerol	30%	100.0	0.0	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	5%	100.0	28.6	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	10%	100.0	9.7	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent	Acetone	20%	100.0	3.4	%	20 mM NaOH Borax buffer	10	60°C	0.5% Casein	free amino acids, Peptides	—	—	Classical aqueous control (in %)
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	29.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	15.5	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	28.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	38.5	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	29.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	31.9	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	50.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	36.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	40.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	54.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	49.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	67.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	61.8	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	50.6	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	70.4	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	n-Hexane	10%	100.0	70.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Glycerol	10%	100.0	68.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase
Stability - Incubation	Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase	Methanol	10%	100.0	74.7	%	Incubation: ?, Assay: 20 mM NaOH Borax buffer	Incubation: ?, Assay: 10	Incubation: Room temperature, Assay: 60°C	0.5% Casein	free amino acids, Peptides	—	—	Non-incubated control (in %), assay in aqueous phase

‹ Prev

1 2 3

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — Incubation