Recombinant protease from Oceanobacillus iheyensis
Enzyme Description
Species
Extremophile
Yes
"haloalkaliphilic" organism
EC Number
Sequence
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022)
β Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research
Β· doi:10.1007/s11356-022-21411-7 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: E3UEQ6 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (42 measurements)
42 measurements β page 2 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Glycerol | 30% | 100.0 | 0.0 | % | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Acetone | 5% | 100.0 | 28.6 | % | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 9.7 | % | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Acetone | 20% | 100.0 | 3.4 | % | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Stability - Incubation | Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 29.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Glycerol | 10% | 100.0 | 15.5 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (15 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 10% | 100.0 | 28.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 38.5 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Glycerol | 10% | 100.0 | 29.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 10% | 100.0 | 31.9 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 50.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Glycerol | 10% | 100.0 | 36.8 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (9 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 10% | 100.0 | 40.8 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 54.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Glycerol | 10% | 100.0 | 49.7 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (6 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 10% | 100.0 | 67.8 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 61.8 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Glycerol | 10% | 100.0 | 50.6 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (3 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 10% | 100.0 | 70.4 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 10% | 100.0 | 70.7 | % | Incubation: ?, Assay: 20 mM NaOH Borax buffer | Incubation: ?, Assay: 10 | Incubation: Room temperature, Assay: 60Β°C | 0.5% Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.