Recombinant protease from Oceanobacillus iheyensis

Enzyme Description

Extremophile
Yes "haloalkaliphilic" organism
EC Number

Sequence

Length: 135 amino acids
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022) β€” Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research  Β· doi:10.1007/s11356-022-21411-7 β†—  Β· Activity - Classical Stability - Incubation
42 measurements
Database ID
UniProt: E3UEQ6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (42 measurements)

42 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase Glycerol 10% 100.0 68.7 % Incubation: ?, Assay: 20 mM NaOH Borax buffer Incubation: ?, Assay: 10 Incubation: Room temperature, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (0 hours at room temperature), measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase Methanol 10% 100.0 74.7 % Incubation: ?, Assay: 20 mM NaOH Borax buffer Incubation: ?, Assay: 10 Incubation: Room temperature, Assay: 60Β°C 0.5% Casein free amino acids , Peptides β€” β€” Non-incubated control (in %), assay in aqueous phase
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*