Lipase ZC12 from Psychrobacter sp. ZY124

Enzyme Description

Species
Psychrobacter sp. ZY124 β†—
Extremophile
Yes "psychrophilic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 358 amino acids
MTLSLYIRAALTPKTLLPILGSISAGVLLMTIQTTSAQAAGQYYNCANANGCKLVDSKYFTSSYTKTQYPVVLAHGLGGFTTLFGVIDYFNGIPEDLMKGGSEVYTTKTSAVNNSEVRGEQLLQQVKTIAAISGESKVNLFGHSQGGIDIRYVAGVAPKYVASVTAVSSPEQGSKTADFVKNVLEPNNTSGQPSNVTTQLVSGVFNLIGGFTDIGSGISFNQIQQQDGWQALVALSTDGAAKFNAKFPAAMPKNYCGQPTSTAVNGIKYYSFSGVGQITSALDPSDYLLAATGVPFAGESNDGLVSACSSRLGYVIRDNYRMNHLDSADQVLGLTAWGESEPKSIYRTQVNRLKNANL
Yue Zhang et al. (2018) β€” Purification and characterization of a novel organic solvent-tolerant and cold-adapted lipase from Psychrobacter sp. ZY124
Extremophiles  Β· doi:10.1007/s00792-018-0997-8 β†—  Β· Activity - Classical Activity + Stability - Incubation
72 measurements ▼
Database ID
UniParc: UPI00080982BE β†—
Sequence Annotation
Explicit - Provided
Protein Source
Purified, cold-adapted bacterium Psychrobacter sp. ZY124

Experimental Data (72 measurements)

72 measurements β€” page 3 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 50% 100 103 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 70% 100 178 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 90% 100 29 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 100 72 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 30% 100 92 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity + Stability - Incubation Activity after incubation (30 days at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 75 47 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 10% 94 94 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (5 hours at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 10% 93 94 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 days at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 10% 75 94 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 10% 94 87 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (5 hours at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 10% 93 87 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 days at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 10% 75 51 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 10% 94 142 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (5 hours at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 10% 93 135 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 days at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 10% 75 61 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 10% 94 122 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (5 hours at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 10% 93 122 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (30 days at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 10% 75 45 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (5 hours at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 93 71 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Activity + Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 10% 94 110 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Water-incubated control (in %), assay in the presence of organic solvent | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
β€Ή Prev
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*