Lipase ZC12 from Psychrobacter sp. ZY124

Enzyme Description

Species
Psychrobacter sp. ZY124 β†—
Extremophile
Yes "psychrophilic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 358 amino acids
MTLSLYIRAALTPKTLLPILGSISAGVLLMTIQTTSAQAAGQYYNCANANGCKLVDSKYFTSSYTKTQYPVVLAHGLGGFTTLFGVIDYFNGIPEDLMKGGSEVYTTKTSAVNNSEVRGEQLLQQVKTIAAISGESKVNLFGHSQGGIDIRYVAGVAPKYVASVTAVSSPEQGSKTADFVKNVLEPNNTSGQPSNVTTQLVSGVFNLIGGFTDIGSGISFNQIQQQDGWQALVALSTDGAAKFNAKFPAAMPKNYCGQPTSTAVNGIKYYSFSGVGQITSALDPSDYLLAATGVPFAGESNDGLVSACSSRLGYVIRDNYRMNHLDSADQVLGLTAWGESEPKSIYRTQVNRLKNANL
Yue Zhang et al. (2018) β€” Purification and characterization of a novel organic solvent-tolerant and cold-adapted lipase from Psychrobacter sp. ZY124
Extremophiles  Β· doi:10.1007/s00792-018-0997-8 β†—  Β· Activity - Classical Activity + Stability - Incubation
72 measurements ▼
Database ID
UniParc: UPI00080982BE β†—
Sequence Annotation
Explicit - Provided
Protein Source
Purified, cold-adapted bacterium Psychrobacter sp. ZY124

Experimental Data (72 measurements)

72 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 50% 100 140 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 70% 100 184 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 90% 100 96 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 30% 100 80 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 50% 100 89 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100 80 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 100 63 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 70% 100 56 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 90% 100 25 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100 89 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 30% 100 91 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 50% 100 81 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 70% 100 85 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 90% 100 42 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100 90 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 50% 100 88 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 70% 100 64 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 90% 100 49 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 10% 100 91 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 30% 100 93 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
β€Ή Prev
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*