Lipase ZC12 from Psychrobacter sp. ZY124

Enzyme Description

Species
Psychrobacter sp. ZY124 β†—
Extremophile
Yes "psychrophilic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 358 amino acids
MTLSLYIRAALTPKTLLPILGSISAGVLLMTIQTTSAQAAGQYYNCANANGCKLVDSKYFTSSYTKTQYPVVLAHGLGGFTTLFGVIDYFNGIPEDLMKGGSEVYTTKTSAVNNSEVRGEQLLQQVKTIAAISGESKVNLFGHSQGGIDIRYVAGVAPKYVASVTAVSSPEQGSKTADFVKNVLEPNNTSGQPSNVTTQLVSGVFNLIGGFTDIGSGISFNQIQQQDGWQALVALSTDGAAKFNAKFPAAMPKNYCGQPTSTAVNGIKYYSFSGVGQITSALDPSDYLLAATGVPFAGESNDGLVSACSSRLGYVIRDNYRMNHLDSADQVLGLTAWGESEPKSIYRTQVNRLKNANL
Yue Zhang et al. (2018) β€” Purification and characterization of a novel organic solvent-tolerant and cold-adapted lipase from Psychrobacter sp. ZY124
Extremophiles  Β· doi:10.1007/s00792-018-0997-8 β†—  Β· Activity - Classical Activity + Stability - Incubation
72 measurements ▼
Database ID
UniParc: UPI00080982BE β†—
Sequence Annotation
Explicit - Provided
Protein Source
Purified, cold-adapted bacterium Psychrobacter sp. ZY124

Experimental Data (72 measurements)

72 measurements β€” page 1 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 90% 100 148 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 70% 100 44 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetonitrile 90% 100 16 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 10% 100 94 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 30% 100 119 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 50% 100 164 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 70% 100 92 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Toluene 90% 100 67 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 10% 100 87 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 30% 100 126 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 50% 100 161 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Pentane 70% 100 187 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 100 87 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 10% 100 135 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 30% 100 149 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 50% 100 174 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 70% 100 181 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Hexane 90% 100 74 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 10% 100 122 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
Activity - Classical Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent n-Octane 30% 100 137 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, ?% isopropanol, 1% Triton X-100, 0.25g/100 mL gum arabic Incubation: 8, Assay: 8 Incubation: 37Β°C, Assay: 37Β°C 10 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” Incubation: 200 rpm Classical aqueous control (in %), assay in the presence of organic solvent | Assay assay over a relatively long period (5 hours)
β€Ή Prev
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*