Protease from Bacillus amyloliquefaciens CMW1

Enzyme Description

Species

Extremophile

EC Number

3.4.21.62 ↗

Sequence

Length: 382 amino acids

MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ

Atsushi Kurata et al. (2016) — Properties of an ionic liquid-tolerant Bacillus amyloliquefaciens CMW1 and its extracellular protease

Extremophiles · doi:10.1007/s00792-016-0832-z ↗ · Activity - Classical

26 measurements ▼

Database ID

UniProt: D4PBI3 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Purified, bacterium Bacillus amyloliquefaciens CMW1

Experimental Data (26 measurements)

26 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Methanol	50%	100	42	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	90	22	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100	25	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	90	28	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100	39	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Formamide	50%	90	10	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides , Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Isopropanol	50%	90	14	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	1-Octanol	50%	90	66	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	1-Octanol	50%	100	72	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Toluene	50%	90	52	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Toluene	50%	100	72	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Chloroform	50%	90	36	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Chloroform	50%	100	44	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Butyl Acetate	50%	90	79	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Butyl Acetate	50%	100	107	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Diethyl Ether	50%	90	106	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Diethyl Ether	50%	100	111	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Ethyl Acetate	50%	90	40	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Ethyl Acetate	50%	100	54	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Formamide	50%	100	35	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Isopropanol	50%	100	23	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Ethanol	50%	90	9	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Ethanol	50%	100	15	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Acetonitrile	50%	90	8	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Acetonitrile	50%	100	21	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Methanol	50%	90	25	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Methanol	50%	100	42	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	90	22	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethylformamide (DMF)	50%	100	25	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	90	28	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	50%	100	39	%	100 mM glycine-NaOH buffer, with 2 mM CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent	Formamide	50%	90	10	%	100 mM glycine-NaOH buffer, without CaCl2	9	55°C	0.25% (w/v) Azocasein	azopeptides, Peptides	—	Yes, "vortex used"	Classical aqueous control (in %)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*