Protease from Bacillus amyloliquefaciens CMW1
Enzyme Description
Sequence
MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
Atsushi Kurata et al. (2016)
β Properties of an ionic liquid-tolerant Bacillus amyloliquefaciens CMW1 and its extracellular protease
Extremophiles
Β· doi:10.1007/s00792-016-0832-z β
Β· Activity - Classical
▼
Database ID
UniProt: D4PBI3 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium Bacillus amyloliquefaciens CMW1
Experimental Data (26 measurements)
26 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Isopropanol | 50% | 90 | 14 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | 1-Octanol | 50% | 90 | 66 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | 1-Octanol | 50% | 100 | 72 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Toluene | 50% | 90 | 52 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Toluene | 50% | 100 | 72 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Chloroform | 50% | 90 | 36 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Chloroform | 50% | 100 | 44 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Butyl Acetate | 50% | 90 | 79 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Butyl Acetate | 50% | 100 | 107 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Diethyl Ether | 50% | 90 | 106 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Diethyl Ether | 50% | 100 | 111 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Ethyl Acetate | 50% | 90 | 40 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Ethyl Acetate | 50% | 100 | 54 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Formamide | 50% | 100 | 35 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Isopropanol | 50% | 100 | 23 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Ethanol | 50% | 90 | 9 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Ethanol | 50% | 100 | 15 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Acetonitrile | 50% | 90 | 8 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Acetonitrile | 50% | 100 | 21 | % | 100 mM glycine-NaOH buffer, with 2 mM CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (colorimetric assay, azo-peptide absorbance measurement, 440 nm) in the presence of organic solvent | Methanol | 50% | 90 | 25 | % | 100 mM glycine-NaOH buffer, without CaCl2 | 9 | 55Β°C | 0.25% (w/v) Azocasein | azopeptides , Peptides | β | Yes, "vortex used" | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.