Esterase (gene EstLiu) from Zunongwangia profunda

Enzyme Description

Extremophile
Yes psychrophilic (and "halo-tolerant" enzyme)
EC Number

Sequence

Length: 293 amino acids
MKTKIIAFLGLFVAVFQLSAQDEVIKLYDGKAPGSEDWNWEEAQKFSDLFKTEVVYNVTDPSLLVFKPETPNGTAIIIAPGGGFQTLSINREGIDLAKELASKGVTAFVLKYRLVHSKTDSPAKELMESLKDRADFDAKRVKIKKLAGQDMQAALKYVRDNAAQFNIAKDKVGVIGFSAGATVALESVLRSASKATLPNFAASLYGGPSDDIMAQDIPKEIPLFIAAASDDQLKLAPKSIALYNKWLAAGYPVELHMYAKGGHGFGMGTQNLPVDTWYKRYEDWLTQYKYLNK
Mohammad Asadur Rahman et al. (2016) β€” Characterization of a novel cold active and salt tolerant esterase from Zunongwangia profunda
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2015.12.013 β†—  Β· Stability - Incubation
42 measurements
Database ID
UniProt: D5BL39 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (42 measurements)

42 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 95 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 20% 100 74 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*