Esterase (gene EstLiu) from Zunongwangia profunda

Enzyme Description

Extremophile
Yes psychrophilic (and "halo-tolerant" enzyme)
EC Number

Sequence

Length: 293 amino acids
MKTKIIAFLGLFVAVFQLSAQDEVIKLYDGKAPGSEDWNWEEAQKFSDLFKTEVVYNVTDPSLLVFKPETPNGTAIIIAPGGGFQTLSINREGIDLAKELASKGVTAFVLKYRLVHSKTDSPAKELMESLKDRADFDAKRVKIKKLAGQDMQAALKYVRDNAAQFNIAKDKVGVIGFSAGATVALESVLRSASKATLPNFAASLYGGPSDDIMAQDIPKEIPLFIAAASDDQLKLAPKSIALYNKWLAAGYPVELHMYAKGGHGFGMGTQNLPVDTWYKRYEDWLTQYKYLNK
Mohammad Asadur Rahman et al. (2016) β€” Characterization of a novel cold active and salt tolerant esterase from Zunongwangia profunda
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2015.12.013 β†—  Β· Stability - Incubation
42 measurements
Database ID
UniProt: D5BL39 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (42 measurements)

42 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Propanol 50% 100 4 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 50% 100 103 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 114 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 20% 100 119 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 102 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 40% 100 68 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 50% 100 81 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 5% 100 133 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100 120 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 20% 100 153 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 30% 100 145 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 40% 100 138 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 5% 100 155 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 5% 100 111 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100 87 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20% 100 82 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100 72 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 40% 100 68 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 67 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 5% 100 117 % Incubation: ?, Assay: 50 mM Tris-HCl Incubation: ?, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 0.5 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
1 2 3

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*