Esterase (gene EstLiu) from Zunongwangia profunda
Enzyme Description
Species
Extremophile
Yes
psychrophilic (and "halo-tolerant" enzyme)
EC Number
Sequence
MKTKIIAFLGLFVAVFQLSAQDEVIKLYDGKAPGSEDWNWEEAQKFSDLFKTEVVYNVTDPSLLVFKPETPNGTAIIIAPGGGFQTLSINREGIDLAKELASKGVTAFVLKYRLVHSKTDSPAKELMESLKDRADFDAKRVKIKKLAGQDMQAALKYVRDNAAQFNIAKDKVGVIGFSAGATVALESVLRSASKATLPNFAASLYGGPSDDIMAQDIPKEIPLFIAAASDDQLKLAPKSIALYNKWLAAGYPVELHMYAKGGHGFGMGTQNLPVDTWYKRYEDWLTQYKYLNK
Mohammad Asadur Rahman et al. (2016)
β Characterization of a novel cold active and salt tolerant esterase from Zunongwangia profunda
Enzyme and Microbial Technology
Β· doi:10.1016/j.enzmictec.2015.12.013 β
Β· Stability - Incubation
▼
Database ID
UniProt: D5BL39 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (42 measurements)
42 measurements β page 1 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 20% | 100 | 70 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 40% | 100 | 62 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 50% | 100 | 39 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 5% | 100 | 120 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 10% | 100 | 101 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 20% | 100 | 97 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 30% | 100 | 80 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 40% | 100 | 98 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 50% | 100 | 79 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 5% | 100 | 96 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10% | 100 | 91 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100 | 89 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30% | 100 | 26 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 40% | 100 | 28 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 50% | 100 | 14 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 5% | 100 | 103 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 10% | 100 | 94 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 20% | 100 | 64 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 30% | 100 | 20 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (40 minutes at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Propanol | 40% | 100 | 9 | % | Incubation: ?, Assay: 50 mM Tris-HCl | Incubation: ?, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 0.5 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.