Phenolic acid decarboxylase (gene blpad) from Bacillus licheniformis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 166 amino acids
MNQDVKEFVGSHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQKADIVKLTEGVYKVSWTEPTGTDVSLNFMPNEKRMHGIIFFPKWVHERPDITVCYQNDHIDLMEESREKYETYPKYVVPEFADITFIENAGIDNEDLISKAPYPGMTDDIRAGKRV
Hongfei Hu et al. (2014) β€” An organic solvent-tolerant phenolic acid decarboxylase from Bacillus licheniformis for the efficient bioconversion of hydroxycinnamic acids to vinyl phenol derivatives
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-014-6313-3 β†—  Β· Activity - Classical Stability - Incubation
45 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (45 measurements)

45 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase Petroleum Ether 50% 100.0 107.42 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Octane 20% 100.0 102.47 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Octane 30% 100.0 106.02 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Octane 50% 100.0 106.84 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Decane 20% 100.0 93.23 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*