Phenolic acid decarboxylase (gene blpad) from Bacillus licheniformis
Enzyme Description
Sequence
MNQDVKEFVGSHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQKADIVKLTEGVYKVSWTEPTGTDVSLNFMPNEKRMHGIIFFPKWVHERPDITVCYQNDHIDLMEESREKYETYPKYVVPEFADITFIENAGIDNEDLISKAPYPGMTDDIRAGKRV
Hongfei Hu et al. (2014)
β An organic solvent-tolerant phenolic acid decarboxylase from Bacillus licheniformis for the efficient bioconversion of hydroxycinnamic acids to vinyl phenol derivatives
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-014-6313-3 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: A0A0B4UFV2 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21
Experimental Data (45 measurements)
45 measurements β page 2 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Hexadecane | 30% | 100.0 | 86.94 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Hexadecane | 20% | 100.0 | 103.5 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Decane | 50% | 100.0 | 42.15 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Hexane | 50% | 100.0 | 99.57 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Toluene | 30% | 100.0 | 126.22 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Toluene | 50% | 100.0 | 128.47 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | 1-Octanol | 20% | 100.0 | 106.45 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | 1-Octanol | 30% | 100.0 | 98.71 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | 1-Octanol | 50% | 100.0 | 90.86 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Cyclohexane | 20% | 100.0 | 102.39 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Cyclohexane | 30% | 100.0 | 102.77 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Cyclohexane | 50% | 100.0 | 108.37 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Hexane | 20% | 100.0 | 93.29 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Hexane | 30% | 100.0 | 102.58 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Toluene | 20% | 100.0 | 131.27 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Heptane | 20% | 100.0 | 99.89 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Heptane | 30% | 100.0 | 102.23 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | n-Heptane | 50% | 100.0 | 100.7 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Petroleum Ether | 20% | 100.0 | 103.93 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase | Petroleum Ether | 30% | 100.0 | 105.56 | % | Incubation: 160 mM NaβHPOββcitric acid buffer, Assay: 160 mM NaβHPOββcitric acid buffer | Incubation: 6, Assay: 6 | Incubation: 37Β°C, Assay: 37Β°C | 5 mM p-Coumaric acid | 4-Vinylphenol , Carbon Dioxide (CO2) | β | Incubation: 200 rpm | Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.