Phenolic acid decarboxylase (gene blpad) from Bacillus licheniformis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 166 amino acids
MNQDVKEFVGSHMIYTYENGWEYEIYIKNDHTIDYRIHSGMVGGRWVRDQKADIVKLTEGVYKVSWTEPTGTDVSLNFMPNEKRMHGIIFFPKWVHERPDITVCYQNDHIDLMEESREKYETYPKYVVPEFADITFIENAGIDNEDLISKAPYPGMTDDIRAGKRV
Hongfei Hu et al. (2014) β€” An organic solvent-tolerant phenolic acid decarboxylase from Bacillus licheniformis for the efficient bioconversion of hydroxycinnamic acids to vinyl phenol derivatives
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-014-6313-3 β†—  Β· Activity - Classical Stability - Incubation
45 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (45 measurements)

45 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Hexadecane 50% 100.0 127.77 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Toluene 50% 100.0 187.38 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent 1-Octanol 50% 100.0 71.89 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Cyclohexane 50% 100.0 85.61 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Hexane 50% 100.0 90.97 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Heptane 50% 100.0 94.53 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Petroleum Ether 50% 100.0 96.32 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Octane 50% 100.0 105.79 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Decane 50% 100.0 124.7 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Hexadecane 50% 100.0 100.3 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Toluene 50% 100.0 186.38 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent 1-Octanol 50% 100.0 70.15 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Cyclohexane 50% 100.0 214.7 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Hexane 50% 100.0 158.5 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Heptane 50% 100.0 119.64 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent Petroleum Ether 50% 100.0 192.59 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Octane 50% 100.0 167.23 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Activity - Classical Activity measured by HPLC in the presence of organic solvent n-Decane 50% 100.0 253.0 % 160 mM Naβ‚‚HPO₄–citric acid buffer 6 37Β°C 5 mM Ferulic acid 4-Vinylguaiacol , Carbon Dioxide (CO2) β€” 200 rpm Classical aqueous control (in %)
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Decane 30% 100.0 92.79 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hour at 25Β°C), measured by HPLC in aqueous phase n-Hexadecane 50% 100.0 91.86 % Incubation: 160 mM Naβ‚‚HPO₄–citric acid buffer, Assay: 160 mM Naβ‚‚HPO₄–citric acid buffer Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 5 mM p-Coumaric acid 4-Vinylphenol , Carbon Dioxide (CO2) β€” Incubation: 200 rpm Non-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*