Ene-reductase KYE1 from Kluyveromyces lactis

Enzyme Description

Species
Kluyveromyces lactis β†—
Extremophile
No
EC Number
1.3.1.31 β†—

Sequence

Length: 398 amino acids
MSFMNFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHPGNVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAIHDNKSFVWVQLWVLGRQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITKDEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAVGAERTSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKRLAYVDLVEPRVTSPFQPEFEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVERLEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGYKK
Yanto Yanto et al. (2011) β€” Asymmetric bioreduction of alkenes using ene-reductases YersER and KYE1 and effects of organic solvents
Organic Letters  Β· doi:10.1021/ol200394p β†—  Β· Stability - C50 Activity + Stability - Conversion Specificity - Enantioselectivity
84 measurements ▼
Database ID
UniProt: P40952 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (84 measurements)

84 measurements β€” page 4 of 5
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 50% 100.0 100.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 40% 100.0 100.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Toluene 10% 86.0 80.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography n-Hexane 50% 86.0 84.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Toluene 20% 86.0 83.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Toluene 40% 86.0 83.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography n-Hexane 40% 86.0 86.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Toluene 50% 86.0 83.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Toluene 30% 86.0 82.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography n-Hexane 30% 86.0 84.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography n-Hexane 20% 86.0 82.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography n-Hexane 10% 86.0 89.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Dimethyl Sulfoxide (DMSO) 50% 86.0 54.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Dimethyl Sulfoxide (DMSO) 40% 86.0 70.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Dimethyl Sulfoxide (DMSO) 30% 86.0 76.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Dimethyl Sulfoxide (DMSO) 20% 86.0 81.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Dimethyl Sulfoxide (DMSO) 10% 86.0 82.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Ethylene Glycol 50% 86.0 60.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Ethylene Glycol 40% 86.0 86.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Ethylene Glycol 30% 86.0 87.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3 4 5
Next β€Ί

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity β€” Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*