Ene-reductase KYE1 from Kluyveromyces lactis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 398 amino acids
MSFMNFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHPGNVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAIHDNKSFVWVQLWVLGRQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITKDEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAVGAERTSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKRLAYVDLVEPRVTSPFQPEFEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVERLEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGYKK
Yanto Yanto et al. (2011) β€” Asymmetric bioreduction of alkenes using ene-reductases YersER and KYE1 and effects of organic solvents
Organic Letters  Β· doi:10.1021/ol200394p β†—  Β· Stability - C50 Activity + Stability - Conversion Specificity - Enantioselectivity
84 measurements
Database ID
UniProt: P40952 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (84 measurements)

84 measurements β€” page 5 of 5
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Ethylene Glycol 20% 86.0 82.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Specificity - Enantioselectivity Enantiomeric excess (toward the R form) after incubation (12 hours at 30Β°C), measured by gas chromatography Ethylene Glycol 10% 86.0 84.0 % 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity, assessed by incubation (12 hours at 30Β°C) in the presence of organic solvent and measured by gas chromatography Ethylene Glycol β€” β€” 43.3 % (v/v) 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity, assessed by incubation (12 hours at 30Β°C) in the presence of organic solvent and measured by gas chromatography Dimethyl Sulfoxide (DMSO) β€” β€” 27.5 % (v/v) 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Not applicable control (in % (v/v))
1 2 3 4 5
Next β€Ί

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity β€” Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*