Purified hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 147 amino acids
MRNPGASFLIKHFLVLSLFLCAGTAHNPPEIVRHIVFNRYKSQLSQKQIDQIIADYGNLQNIAPEMKEWKWGTDLGPAVEDRADGFTHAYESTFHSVADFLNFFYSPPALEFAKEFFPACEKIVVLNYIINETFPYTWALPNKYVVT
Techawaree Ueatrongchit et al. (2010) β€” Hydroxynitrile lyase from Passiflora edulis: Purification, characteristics and application in asymmetric synthesis of (R)-mandelonitrile
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2010.02.008 β†—  Β· Activity - Classical Stability - Incubation Selectivity - Enantioselectivity
32 measurements
Database ID
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, eukaryote Passiflora edulis (passion fruit)

Experimental Data (32 measurements)

32 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 80% 30.0 0.74 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 80% 30.0 10.8 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 90% 30.0 10.2 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 95% 30.0 7.9 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 70% 30.0 11.5 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 60% 30.0 12.7 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 50% 30.0 13.4 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Butyl Ether 40% 30.0 11.5 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent n-Hexane 80% 30.0 3.5 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Diisopropyl Ether 80% 30.0 1.16 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 80% 30.0 0.23 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Diethyl Ether 80% 30.0 0.42 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Activity - Classical Initial reaction rate (in Β΅M/hour) measured by HPLC in the presence of organic solvent Ethyl Acetate 80% 30.0 0.0 Β΅M/hour 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in microM/hour)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 80% 59.0 99.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 90% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 95% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 80% 59.0 99.3 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 70% 59.0 99.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 60% 59.0 98.4 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 50% 59.0 98.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
β€Ή Prev
1 2

Visualization : Activity β€” Classical

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Aem Nuylert et al. (2017) β€” Effect of Glycosylation on the Biocatalytic Properties of Hydroxynitrile Lyase from the Passion Fruit, Passiflora edulis : A Comparison of Natural and Recombinant Enzymes
ChemBioChem  Β· doi:10.1002/cbic.201600447 β†—  Β· Stability - Incubation Selectivity - Enantioselectivity
12 measurements

Structure

🧬

No structure available for this protein.