Purified hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 147 amino acids
MRNPGASFLIKHFLVLSLFLCAGTAHNPPEIVRHIVFNRYKSQLSQKQIDQIIADYGNLQNIAPEMKEWKWGTDLGPAVEDRADGFTHAYESTFHSVADFLNFFYSPPALEFAKEFFPACEKIVVLNYIINETFPYTWALPNKYVVT
Techawaree Ueatrongchit et al. (2010) β€” Hydroxynitrile lyase from Passiflora edulis: Purification, characteristics and application in asymmetric synthesis of (R)-mandelonitrile
Enzyme and Microbial Technology  Β· doi:10.1016/j.enzmictec.2010.02.008 β†—  Β· Activity - Classical Stability - Incubation Selectivity - Enantioselectivity
32 measurements
Database ID
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, eukaryote Passiflora edulis (passion fruit)

Experimental Data (32 measurements)

32 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Butyl Ether 40% 59.0 97.5 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent n-Hexane 80% 59.0 69.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Diisopropyl Ether 80% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 80% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Diethyl Ether 80% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Selectivity - Enantioselectivity Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent Ethyl Acetate 80% 59.0 100.0 % 400 mM citrate-phosphate buffer 4 10Β°C 500 mM Acetone cyanohydrin, 250 mM Benzaldehyde (R)-Mandelonitrile β€” 1500 rpm Classical aqueous control (in %)
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase Ethyl Acetate 50% 100.0 42.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase n-Hexane 50% 100.0 88.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase Butyl Ether 50% 100.0 92.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase Diisopropyl Ether 50% 100.0 86.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase tert-Butyl Methyl Ether (MTBE) 50% 100.0 100.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by chromatography in aqueous phase Diethyl Ether 50% 100.0 70.0 % 400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay Incubation: 4, Assay: 4 Incubation: 10Β°C, Assay: 10Β°C Acetone cyanohydrin, Benzaldehyde (R)-Mandelonitrile β€” Incubation: 1500 rpm Water-incubated control (in %), assay and control in aqueous phase
1 2
Next β€Ί

Visualization : Activity β€” Classical

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Aem Nuylert et al. (2017) β€” Effect of Glycosylation on the Biocatalytic Properties of Hydroxynitrile Lyase from the Passion Fruit, Passiflora edulis : A Comparison of Natural and Recombinant Enzymes
ChemBioChem  Β· doi:10.1002/cbic.201600447 β†—  Β· Stability - Incubation Selectivity - Enantioselectivity
12 measurements

Structure

🧬

No structure available for this protein.