Purified hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Species

Extremophile

EC Number

4.1.2.10 ↗

Sequence

Length: 147 amino acids

MRNPGASFLIKHFLVLSLFLCAGTAHNPPEIVRHIVFNRYKSQLSQKQIDQIIADYGNLQNIAPEMKEWKWGTDLGPAVEDRADGFTHAYESTFHSVADFLNFFYSPPALEFAKEFFPACEKIVVLNYIINETFPYTWALPNKYVVT

Techawaree Ueatrongchit et al. (2010) — Hydroxynitrile lyase from Passiflora edulis: Purification, characteristics and application in asymmetric synthesis of (R)-mandelonitrile

Enzyme and Microbial Technology · doi:10.1016/j.enzmictec.2010.02.008 ↗ · Activity - Classical Stability - Incubation Specificity - Enantioselectivity

32 measurements ▼

Database ID

UniProt: A0A1L7NZN4 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Purified, eukaryote Passiflora edulis (passion fruit)

Experimental Data (32 measurements)

32 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	40%	59.0	97.5	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	n-Hexane	80%	59.0	69.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Diisopropyl Ether	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Diethyl Ether	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Ethyl Acetate	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Ethyl Acetate	50%	100.0	42.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	n-Hexane	50%	100.0	88.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Butyl Ether	50%	100.0	92.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Diisopropyl Ether	50%	100.0	86.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	tert-Butyl Methyl Ether (MTBE)	50%	100.0	100.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Diethyl Ether	50%	100.0	70.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase

—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	80%	30.0	0.74	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	80%	30.0	10.8	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	90%	30.0	10.2	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	95%	30.0	7.9	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	70%	30.0	11.5	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	60%	30.0	12.7	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	50%	30.0	13.4	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Butyl Ether	40%	30.0	11.5	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	n-Hexane	80%	30.0	3.5	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Diisopropyl Ether	80%	30.0	1.16	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	80%	30.0	0.23	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Diethyl Ether	80%	30.0	0.42	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Activity - Classical	Initial reaction rate (in µM/hour) measured by HPLC in the presence of organic solvent	Ethyl Acetate	80%	30.0	0.0	µM/hour	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in µM/hour)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	80%	59.0	99.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	90%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	95%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	80%	59.0	99.3	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	70%	59.0	99.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	60%	59.0	98.4	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	50%	59.0	98.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Butyl Ether	40%	59.0	97.5	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	n-Hexane	80%	59.0	69.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Diisopropyl Ether	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Diethyl Ether	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) measured by HPLC in the presence of organic solvent	Ethyl Acetate	80%	59.0	100.0	%	400 mM citrate-phosphate buffer	4	10°C	500 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	1500 rpm	Classical aqueous control (in %)
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Ethyl Acetate	50%	100.0	42.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	n-Hexane	50%	100.0	88.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Butyl Ether	50%	100.0	92.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Diisopropyl Ether	50%	100.0	86.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	tert-Butyl Methyl Ether (MTBE)	50%	100.0	100.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase
—	Stability - Incubation	Activity after incubation (12 hours at 30°C), measured by chromatography in aqueous phase	Diethyl Ether	50%	100.0	70.0	%	400 mM citrate-phosphate buffer, 400 mM citrate-phosphate buffer assay	Incubation: 4, Assay: 4	Incubation: 10°C, Assay: 10°C	Acetone cyanohydrin, Benzaldehyde	(R)-Mandelonitrile	—	Incubation: 1500 rpm	Water-incubated control (in %), assay and control in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability — Incubation

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity — Enantioselectivity

Techawaree Ueatrongchit et al. (2010)

One bar per measurement. Colour = solvent, shade = solvent volume.

Aem Nuylert et al. (2017) — Effect of Glycosylation on the Biocatalytic Properties of Hydroxynitrile Lyase from the Passion Fruit, Passiflora edulis : A Comparison of Natural and Recombinant Enzymes

ChemBioChem · doi:10.1002/cbic.201600447 ↗ · Stability - Incubation Specificity - Enantioselectivity

12 measurements ▼

Database ID

UniProt: A0A1L7NZN4 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Purified, eukaryote Passiflora edulis (passion fruit)

Experimental Data (12 measurements)

12 measurements

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	50.4	96.4	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	50.4	95.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	50.4	95.9	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	50.4	96.6	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Butyl Ether	50%	50.4	94.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	n-Hexane	50%	50.4	47.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Ethyl Acetate	50%	88.7	68.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Diethyl Ether	50%	88.7	89.5	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	50%	88.7	81.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Diisopropyl Ether	50%	88.7	81.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Butyl Ether	50%	88.7	70.0	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	n-Hexane	50%	88.7	70.0	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN

WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Ethyl Acetate	50%	50.4	96.4	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Diethyl Ether	50%	50.4	95.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	tert-Butyl Methyl Ether (MTBE)	50%	50.4	95.9	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Diisopropyl Ether	50%	50.4	96.6	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	Butyl Ether	50%	50.4	94.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Specificity - Enantioselectivity	Enantiomeric excess (toward R form) after 12 hours incubation at 10°C in the presence of organic solvent, measured by HPLC	n-Hexane	50%	50.4	47.2	%	400 mM citrate buffer	4	10°C	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Classical aqueous control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Ethyl Acetate	50%	88.7	68.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Diethyl Ether	50%	88.7	89.5	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	tert-Butyl Methyl Ether (MTBE)	50%	88.7	81.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Diisopropyl Ether	50%	88.7	81.3	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	Butyl Ether	50%	88.7	70.0	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN
WT	Stability - Incubation	Activity after incubation (12 hours at 10°C), measured by HPLC in presence of organic solvent	n-Hexane	50%	88.7	70.0	%	Incubation: 400 mM citrate buffer, Assay: 400 mM citrate buffer	Incubation: 4, Assay: 4	?	900 mM Acetone cyanohydrin, 250 mM Benzaldehyde	(R)-Mandelonitrile	—	—	Water-incubated control (in %), with activity measured in the presence of organic solvent before and after incubation for determining 100% value \| Acetone cyanohydrin forms HCN

Visualization : Stability — Incubation

Aem Nuylert et al. (2017)

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Visualization : Specificity — Enantioselectivity

Aem Nuylert et al. (2017)

One bar per measurement. Colour = solvent, shade = solvent volume. — — — Reference value. Hover for details.

Structure

🧬

No structure available for this protein.

Purified hydroxynitrile lyase (gene PeHNL) from Passiflora edulis (passion fruit)

Enzyme Description

Sequence

Experimental Data (32 measurements)

Visualization : Activity — Classical

Visualization : Stability — Incubation

Visualization : Specificity — Enantioselectivity

Experimental Data (12 measurements)

Visualization : Stability — Incubation

Visualization : Specificity — Enantioselectivity

Structure

Loading…