Tyrosinase from Bacillus megaterium

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 297 amino acids
MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
Vered Shuster et al. (2009) β€” Isolation, Cloning and Characterization of a Tyrosinase with Improved Activity in Organic Solvents from Bacillus megaterium ;
Microbial Physiology  Β· doi:10.1159/000233506 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - Incubation Specificity - Reaction Specificity
66 measurements
Database ID
UniProt: B2ZB02 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (66 measurements)

66 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 60% 61.0 29.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 50% 61.0 60.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 40% 61.0 76.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 30% 61.0 83.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 20% 61.0 90.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 10% 61.0 74.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Specificity β€” Reaction Specificity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*