Tyrosinase from Bacillus megaterium

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 297 amino acids
MSNKYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNAAHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADFMGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVLNALKITQYDTPPWDMTSQNSFRNQLEGFINGPQLHNRVHRWVGGQMGVVPTAPNDPVFFLHHANVDRIWAVWQIIHRNQNYQPMKNGPFGQNFRDPMYPWNTTPEDVMNHRKLGYVYDIELRKSKRSS
Vered Shuster et al. (2009) β€” Isolation, Cloning and Characterization of a Tyrosinase with Improved Activity in Organic Solvents from Bacillus megaterium ;
Microbial Physiology  Β· doi:10.1159/000233506 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - Incubation Selectivity - Chemoselectivity
66 measurements
Database ID
UniProt: B2ZB02 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (66 measurements)

66 measurements β€” page 3 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorabce measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 1.18 1.7 mM 50 mM potassium phosphate buffer 7 25Β°C D-DOPA (D-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Classical aqueous control (in mM)
Activity - Michaelis-Menten kcat/Km (1/(mM*s)) measured by absorbance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorabce measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 28900.0 29200.0 1/(mM * s) 50 mM potassium phosphate buffer 7 25Β°C L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Classical aqueous control (in 1/(mM * s))
Activity - Michaelis-Menten kcat (/s) measured by absorbance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorabce measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 10.1 21.3 1/s 50 mM potassium phosphate buffer 7 25Β°C L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Classical aqueous control (in 1/s)
Activity - Michaelis-Menten Km (mM) measured by absorbance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorabce measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 0.35 0.73 mM 50 mM potassium phosphate buffer 7 25Β°C L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Classical aqueous control (in mM)
Selectivity - Chemoselectivity (kcat/kM)L/(kcat/kM)D measured by absorbance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorabce measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 5.7 4.1 ratio (kcat/kM)L/(kcat/kM 50 mM potassium phosphate buffer 7 25Β°C D-DOPA (D-3,4-Dihydroxyphenylalanine), L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Classical aqueous control (in ratio (kcat/kM)L/(kcat/kM)D)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 50% 61.0 66.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 70% 61.0 0.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 60% 61.0 64.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 70% 61.0 52.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 61.0 54.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20% 61.0 59.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30% 61.0 48.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40% 61.0 43.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50% 61.0 7.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 60% 61.0 0.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 40% 61.0 69.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 30% 61.0 62.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 20% 61.0 58.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Methanol 10% 61.0 64.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
Stability - Incubation Activity after incubation (17 hours at 30Β°C), measured by absorance spectrophotometry (dopaquinone spontaneous cyclization product, dopachrome, absorbance measurement, 475 nm) in the presence of organic solvent Ethanol 70% 61.0 7.0 % Incubation: 50 mM potassium phosphate buffer, Assay: 50 mM potassium phosphate buffer 7 buffer, 7 assay Incubation: 30Β°C, Assay: 25Β°C 1 mM L-DOPA (L-3,4-Dihydroxyphenylalanine) Dopaquinone β€” β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation (mean of 3 measurements provided)
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Chemoselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*