Cutinase (gene MmCut3) from Mycobacterium marinum
Enzyme Description
Sequence
MNKHPLAVLAGALVTATGLLAAPSITGTAIPSASAADCPDAEVVFARGTSEPPGIGRVGEAFVDSLRQQTGKNIGVYAVNYPASRLQLHGGDGANDVISHVKSMASSCPNTKIVLGGYSQGADVIDIVAGVPLAGISFGNELPAQYADNIAAVAVFGNVANRSGGSLTTQSSLLGSKSIDLCNPSDPICHSGPGNDWNGHTDGYVPTYTTQAASFVAAKLAASSMAPVVQLPGPVPRAPGPAPQAPGPATASPGTPVGATGTLVGAH
Jayashree Ravi et al. (2025)
β Enzymatic biodegradation of Poly(Ξ΅-Caprolactone) (PCL) by a thermostable cutinase from a mesophilic bacteria Mycobacterium marinum
Science of The Total Environment
Β· doi:10.1016/j.scitotenv.2025.179066 β
Β· Activity + Stability - Incubation
▼
Database ID
UniProt: B2HCY2 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (36 measurements)
36 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Methoxyethanol | 10% | 100.0 | 0.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethyl Acetate | 40% | 100.0 | 72.8 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethyl Acetate | 60% | 100.0 | 70.2 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Phenol | 10% | 100.0 | 35.8 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Phenol | 40% | 100.0 | 5.6 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Phenol | 60% | 100.0 | 0.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Benzene | 10% | 100.0 | 45.5 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Benzene | 40% | 100.0 | 12.5 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Benzene | 60% | 100.0 | 0.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethyl Acetate | 10% | 100.0 | 220.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Methoxyethanol | 40% | 100.0 | 0.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Methoxyethanol | 60% | 100.0 | 0.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Hexylene Glycol | 10% | 100.0 | 59.2 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Hexylene Glycol | 40% | 100.0 | 59.3 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Hexylene Glycol | 60% | 100.0 | 10.5 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Chloroform | 10% | 100.0 | 182.2 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Chloroform | 40% | 100.0 | 150.0 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Chloroform | 60% | 100.0 | 54.2 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 10% | 100.0 | 21.4 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
| Activity + Stability - Incubation | Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40% | 100.0 | 12.7 | % | Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol | Incubation: 8.5, Assay: 8.5 | Incubation: 45Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent |
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.