Cutinase (gene MmCut3) from Mycobacterium marinum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 267 amino acids
MNKHPLAVLAGALVTATGLLAAPSITGTAIPSASAADCPDAEVVFARGTSEPPGIGRVGEAFVDSLRQQTGKNIGVYAVNYPASRLQLHGGDGANDVISHVKSMASSCPNTKIVLGGYSQGADVIDIVAGVPLAGISFGNELPAQYADNIAAVAVFGNVANRSGGSLTTQSSLLGSKSIDLCNPSDPICHSGPGNDWNGHTDGYVPTYTTQAASFVAAKLAASSMAPVVQLPGPVPRAPGPAPQAPGPATASPGTPVGATGTLVGAH
Jayashree Ravi et al. (2025) β€” Enzymatic biodegradation of Poly(Ξ΅-Caprolactone) (PCL) by a thermostable cutinase from a mesophilic bacteria Mycobacterium marinum
Science of The Total Environment  Β· doi:10.1016/j.scitotenv.2025.179066 β†—  Β· Activity + Stability - Incubation
36 measurements
Database ID
UniProt: B2HCY2 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (36 measurements)

36 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 60% 100.0 10.1 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 10% 100.0 68.0 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 40% 100.0 43.7 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Methanol 60% 100.0 29.0 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 10% 100.0 84.5 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 40% 100.0 45.9 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Ethanol 60% 100.0 45.5 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10% 100.0 57.6 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 40% 100.0 16.8 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isoamyl Alcohol 60% 100.0 10.8 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 10% 100.0 37.1 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 40% 100.0 11.2 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Isopropanol 60% 100.0 0.0 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 10% 100.0 88.1 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 40% 100.0 45.7 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
Activity + Stability - Incubation Activity after incubation (45 minutes at 45Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent Acetone 60% 100.0 16.2 % Incubation: ?, Assay: 20 mM Tris-HCl buffer, 50 mM NaCl, 10 % glycerol Incubation: 8.5, Assay: 8.5 Incubation: 45Β°C, Assay: 25Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay was with or without organic solvent
1 2
Next β€Ί

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*