Unspecific peroxygenase (gene HspUPO) from Hypoxylon sp. EC38
Enzyme Description
Sequence
MKSLSFSLALGFGSTLVYSAPSPSSGWQAPGPNDVRAPCPMLNTLANHGFLPHDGKGITVNKTIDALGSALNIDANLSTLLFGFAATTNPQPNATFFDLDHLSRHNILEHDASLSRQDSYFGPADVFNEAVFNQTKSFWTGDIIDVQMAANARIVRLLTSNLTNPEYSLSDLGSAFSIGESAAYIGILGDKKSATVPKSWVEYLFENERLPYELGFKRPNDPFTTDDLGDLSTQIINAQHFPQSPGKVEKRGDTRCPYGYH
Laura Rotilio et al. (2021)
β Structural and Biochemical Studies Enlighten the Unspecific Peroxygenase from Hypoxylon sp. EC38 as an Efficient Oxidative Biocatalyst
ACS Catalysis
Β· doi:10.1021/acscatal.1c03065 β
Β· Activity - Classical
▼
Database ID
UniProt: A0ACD6BA37 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris
Experimental Data (28 measurements)
28 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetonitrile | 30% | 100 | 62 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetonitrile | 30% | 100 | 1 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetonitrile | 20% | 100 | 16 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetonitrile | 10% | 100 | 40 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetonitrile | 5% | 100 | 100 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetone | 20% | 100 | 12 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetone | 10% | 100 | 32 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetone | 5% | 100 | 100 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetone | 2% | 100 | 100 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 0 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20% | 100 | 5 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10% | 100 | 12 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 5% | 100 | 92 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 2% | 100 | 98 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Dimethyl Sulfoxide (DMSO) | 2% | 100 | 100 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetonitrile | 20% | 100 | 356 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetonitrile | 10% | 100 | 580 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetonitrile | 5% | 100 | 470 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetonitrile | 2% | 100 | 0 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent | Acetone | 30% | 100 | 12 | % | 200 mM sodium citrate buffer | 4.5 | 25Β°C | 30 Β΅M ABTS, 2 mM HβOβ (Hydrogen Peroxide) | ABTS radical cation | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
Laura Rotilio et al. (2021)
One bar per measurement. Colour = solvent, shade = solvent volume.
Anica Dadwal et al. (2021)
β Recombinant cellobiohydrolase of Myceliophthora thermophila: characterization and applicability in cellulose saccharification
AMB Express
Β· doi:10.1186/s13568-021-01311-8 β
Β· Activity - Classical
▼
Database ID
UniProt: A0ACD6BA37 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host yeast Pichia pastoris
Experimental Data (1 measurement)
1 measurement
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent | Acetone | 30% | 100 | 0 | % | 50 mM potassium phosphate buffer | 7.4 | 25Β°C | 2 mM HβOβ (Hydrogen Peroxide), 100 Β΅M Indole | Hydroxylated indole derivatives including indigo | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
Anica Dadwal et al. (2021)
One bar per measurement. Colour = solvent, shade = solvent volume.