Unspecific peroxygenase (gene HspUPO) from Hypoxylon sp. EC38

Enzyme Description

Species

Extremophile

EC Number

1.11.2.1 ↗

Sequence

Length: 261 amino acids

MKSLSFSLALGFGSTLVYSAPSPSSGWQAPGPNDVRAPCPMLNTLANHGFLPHDGKGITVNKTIDALGSALNIDANLSTLLFGFAATTNPQPNATFFDLDHLSRHNILEHDASLSRQDSYFGPADVFNEAVFNQTKSFWTGDIIDVQMAANARIVRLLTSNLTNPEYSLSDLGSAFSIGESAAYIGILGDKKSATVPKSWVEYLFENERLPYELGFKRPNDPFTTDDLGDLSTQIINAQHFPQSPGKVEKRGDTRCPYGYH

Laura Rotilio et al. (2021) — Structural and Biochemical Studies Enlighten the Unspecific Peroxygenase from Hypoxylon sp. EC38 as an Efficient Oxidative Biocatalyst

ACS Catalysis · doi:10.1021/acscatal.1c03065 ↗ · Activity - Classical

28 measurements ▼

Database ID

UniProt: A0ACD6BA37 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host yeast Pichia pastoris

Experimental Data (28 measurements)

28 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	20%	100	87	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	10%	100	157	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	5%	100	187	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	2%	100	0	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	0	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	5	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	5	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	11	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)

Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetonitrile	30%	100	62	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetonitrile	30%	100	1	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetonitrile	20%	100	16	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetonitrile	10%	100	40	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetonitrile	5%	100	100	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetone	20%	100	12	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetone	10%	100	32	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetone	5%	100	100	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetone	2%	100	100	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	0	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	5	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	12	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	92	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Dimethyl Sulfoxide (DMSO)	2%	100	98	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	2%	100	100	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetonitrile	20%	100	356	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetonitrile	10%	100	580	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetonitrile	5%	100	470	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetonitrile	2%	100	0	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	30%	100	12	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	20%	100	87	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	10%	100	157	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	5%	100	187	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Acetone	2%	100	0	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	30%	100	0	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	20%	100	5	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	10%	100	5	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)
Activity - Classical	Activity measured by absorbance spectrophotometry (ABTS radical cation reaction products absorbance measurement, 405 nm) with oragnic solvent	Dimethyl Sulfoxide (DMSO)	5%	100	11	%	200 mM sodium citrate buffer	4.5	25°C	30 µM ABTS, 2 mM H₂O₂ (Hydrogen Peroxide)	ABTS radical cation	—	—	Classical aqueous control (in %)

‹ Prev

1 2

Next ›

Visualization : Activity — Classical

Laura Rotilio et al. (2021)

One bar per measurement. Colour = solvent, shade = solvent volume.

Anica Dadwal et al. (2021) — Recombinant cellobiohydrolase of Myceliophthora thermophila: characterization and applicability in cellulose saccharification

AMB Express · doi:10.1186/s13568-021-01311-8 ↗ · Activity - Classical

1 measurement ▼

Database ID

UniProt: A0ACD6BA37 ↗

Sequence Annotation

Explicit - Provided GenBank Accession Number

Protein Source

Recombinant, host yeast Pichia pastoris

Experimental Data (1 measurement)

1 measurement

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Activity - Classical	Activity measured by absorbance spectrophotometry (indole and related compounds absorbance measurement, 670 nm) in the presence of organic solvent	Acetone	30%	100	0	%	50 mM potassium phosphate buffer	7.4	25°C	2 mM H₂O₂ (Hydrogen Peroxide), 100 µM Indole	Hydroxylated indole derivatives including indigo	—	—	Classical aqueous control (in %)

Visualization : Activity — Classical

Anica Dadwal et al. (2021)

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Unspecific peroxygenase (gene HspUPO) from Hypoxylon sp. EC38

Enzyme Description

Sequence

Experimental Data (28 measurements)

Visualization : Activity — Classical

Experimental Data (1 measurement)

Visualization : Activity — Classical

Structure

Loading…