N-terminal truncated (54 residues) esterase (gene estA1) from Alteromonas sp. 39-G1
Enzyme Description
Sequence
PAKTLPLPSASSDELKSAISQYPMPSVDEVINNTPQSIEQWRELIQIRNADQKKKIKKMRKQFDVDVSLEKINGVPVRRLTPKTIAPEFKNKVFIDVHGGAYVFFSGLPSIEESLLIAHRVGITVISIDYSMPPHAPFPAALNDVVSVYSSVAAEHGAQNLFIGGTSAGAGLVLAAVQTLIADKQPLPAAVYAGTPWADLTKTGDTLYTNEGVDRILVTYQGFLEAAANLYAGSESLTHSSISPLYGNFDGFPPTFLISGTRDMFLSDTVRVNRKLRDAQVRTQLEVFEGLSHADYVVAYETPESHSVYQELKQFLLSVCTKSSD
Seok-Jae Won et al. (2020)
β Characterization of Novel Salt-Tolerant Esterase Isolated from the Marine Bacterium Alteromonas sp. 39-G1
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.1907.07057 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI000C1070DA β
Sequence Annotation
Explicit (first 54 residues from UniProt sequence removed)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 30% | 100 | 55 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 50% | 100 | 131 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Cyclohexane | 50% | 100 | 147 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 50% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 50% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 50% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 50% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 50% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50% | 100 | 88 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 30% | 100 | 119 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Cyclohexane | 30% | 100 | 127 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15% | 100 | 81 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30% | 100 | 0 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100 | 71 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100 | 101 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 15% | 100 | 108 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Cyclohexane | 15% | 100 | 119 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (30 minutes at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 15% | 100 | 103 | % | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 40Β°C | 0.1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.