N-terminal truncated (54 residues) esterase (gene estA1) from Alteromonas sp. 39-G1

Enzyme Description

Species

Extremophile

EC Number

3.1.1.1 ↗

Sequence

Length: 325 amino acids

PAKTLPLPSASSDELKSAISQYPMPSVDEVINNTPQSIEQWRELIQIRNADQKKKIKKMRKQFDVDVSLEKINGVPVRRLTPKTIAPEFKNKVFIDVHGGAYVFFSGLPSIEESLLIAHRVGITVISIDYSMPPHAPFPAALNDVVSVYSSVAAEHGAQNLFIGGTSAGAGLVLAAVQTLIADKQPLPAAVYAGTPWADLTKTGDTLYTNEGVDRILVTYQGFLEAAANLYAGSESLTHSSISPLYGNFDGFPPTFLISGTRDMFLSDTVRVNRKLRDAQVRTQLEVFEGLSHADYVVAYETPESHSVYQELKQFLLSVCTKSSD

Seok-Jae Won et al. (2020) — Characterization of Novel Salt-Tolerant Esterase Isolated from the Marine Bacterium Alteromonas sp. 39-G1

Journal of Microbiology and Biotechnology · doi:10.4014/jmb.1907.07057 ↗ · Stability - Incubation

24 measurements ▼

Database ID

UniParc: UPI000C1070DA ↗

Sequence Annotation

Explicit (first 54 residues from UniProt sequence removed)

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (24 measurements)

24 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	15%	100	112	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	15%	100	86	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	15%	100	39	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	15%	100	83	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent

Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	30%	100	55	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	50%	100	131	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Cyclohexane	50%	100	147	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	50%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	50%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	50%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	50%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	50%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	50%	100	88	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	30%	100	119	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Cyclohexane	30%	100	127	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	15%	100	81	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	30%	100	0	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100	71	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100	101	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	n-Hexane	15%	100	108	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Cyclohexane	15%	100	119	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	15%	100	103	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetone	15%	100	112	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	15%	100	86	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	15%	100	39	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent
Stability - Incubation	Activity after incubation (30 minutes at 30°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	15%	100	83	%	Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 4% Ethanol, 1% acetonitrile	Incubation: 8, Assay: 8	Incubation: 30°C, Assay: 40°C	0.1 mM p-Nitrophenol acetate	Acetic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether assay was really in aqueous conditions or in the presence of organic solvent

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*