Esterase (gene Est903) from a paper mill sludge metagenomic library
Enzyme Description
Species
Na (paper mill sludge metagenomic library)
Extremophile
No
but "alkali-tolerant" enzyme
EC Number
Sequence
MVVGYSRVKDTSMRSVLCSWWFTFSAGIFAIPFSTGEDLLAIDSPAVKADVVYGHKDGMALTMDVFEPTGEANGAGLMFMVSGGWVSTWSPPDRMLPLIQPLLQRGYKVIAVRHGSSPRYVIPEIVSDVRLAHEFVHDHAKEWNIDPEKIGVFGFSAGGHLSLVLGTTSNGDADRKAGRKARIAAVAAVFPPTDLRPYMALDNPLREKFPALKFPLDQGPDYSPLLQVSPDDAPTVLIHGDKDELVPIWHSEKISSAFDELKVPTELLVIEGAAHGFDAEGNKRMFTAMVQWFDKHLLGK
Mei-Lu Jia et al. (2019)
β Expression and characterization of an esterase belonging to a new family via isolation from a metagenomic library of paper mill sludge
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2019.01.025 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI000E104C98 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (28 measurements)
28 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 102.8 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 30% | 100.0 | 40.7 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 15% | 100.0 | 61.0 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30% | 100.0 | 31.3 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 15% | 100.0 | 72.6 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100.0 | 78.5 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 15% | 100.0 | 105.4 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 30% | 100.0 | 34.5 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 15% | 100.0 | 85.5 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 30% | 100.0 | 42.9 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetone | 15% | 100.0 | 80.2 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30% | 100.0 | 9.6 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 15% | 100.0 | 26.4 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (24 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 68.0 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 15% | 100.0 | 125.0 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 30% | 100.0 | 79.4 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 15% | 100.0 | 80.2 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30% | 100.0 | 59.7 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 15% | 100.0 | 91.7 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100.0 | 132.2 | % | Incubation: ?, Assay: 40 mM Britton-Robinson buffer | Incubation: ?, Assay: 9 | Incubation: 4Β°C, Assay: 51Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.