Esterase (gene Est903) from a paper mill sludge metagenomic library

Enzyme Description

Species
Na (paper mill sludge metagenomic library)
Extremophile
No but "alkali-tolerant" enzyme
EC Number

Sequence

Length: 300 amino acids
MVVGYSRVKDTSMRSVLCSWWFTFSAGIFAIPFSTGEDLLAIDSPAVKADVVYGHKDGMALTMDVFEPTGEANGAGLMFMVSGGWVSTWSPPDRMLPLIQPLLQRGYKVIAVRHGSSPRYVIPEIVSDVRLAHEFVHDHAKEWNIDPEKIGVFGFSAGGHLSLVLGTTSNGDADRKAGRKARIAAVAAVFPPTDLRPYMALDNPLREKFPALKFPLDQGPDYSPLLQVSPDDAPTVLIHGDKDELVPIWHSEKISSAFDELKVPTELLVIEGAAHGFDAEGNKRMFTAMVQWFDKHLLGK
Mei-Lu Jia et al. (2019) β€” Expression and characterization of an esterase belonging to a new family via isolation from a metagenomic library of paper mill sludge
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2019.01.025 β†—  Β· Stability - Incubation
28 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (28 measurements)

28 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 15% 100.0 122.6 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 30% 100.0 92.0 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 15% 100.0 103.1 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 30% 100.0 71.7 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 15% 100.0 89.1 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 30% 100.0 24.0 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 15% 100.0 70.5 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100.0 119.1 % Incubation: ?, Assay: 40 mM Britton-Robinson buffer Incubation: ?, Assay: 9 Incubation: 4Β°C, Assay: 51Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*