Transglutaminase from Streptomyces mobaraensis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 339 amino acids
DSDDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGVTWVNSGQYPTNRLAFASFDEDRFKNELKNGRPRSGETRAEFEGRVAKESFDEEKGFQRAREVASVMNRALENAHDESAYLDNLKKELANGNDALRNEDARSPFYSALRNTPSFKERNGGNHDPSRMKAVIYSKHFWSGQDRSSSADKRKYGDPDAFRPAPGTGLVDMSRDRNIPRSPTSPGEGFVNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSEGYSDFDRGAYVITFIPKSWNTAPDKVKQGWPLEHHHHHH
Gabe Javitt et al. (2017) β€” Constitutive expression of active microbial transglutaminase in Escherichia coli and comparative characterization to a known variant
BMC Biotechnology  Β· doi:10.1186/s12896-017-0339-4 β†—  Β· Activity - Classical Activity + Stability - Incubation
104 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number (first residue absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (104 measurements)

104 measurements β€” page 1 of 6
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 10% 100 β€” 90 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 20% 100 β€” 59 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 30% 100 β€” 49 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 40% 100 β€” 34 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 50% 100 β€” 20 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 60% 100 β€” 24 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Ethanol 70% 100 β€” 18 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 10% 100 β€” 88 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 20% 100 β€” 88 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 30% 100 β€” 67 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 40% 100 β€” 38 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 50% 100 β€” 39 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 60% 100 β€” 54 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Isopropanol 70% 100 β€” 65 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 10% 100 β€” 99 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 20% 100 β€” 94 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 30% 100 β€” 116 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 40% 100 β€” 79 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 50% 100 β€” 54 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
WT Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, FeCl3 reagant and hydroxamate reaction product absorbance measurement, 525 nm) in the presence of organic solvent Methanol 60% 100 β€” 20 % 356 mM Tris-acetate buffer, 10 mM sodium phosphate buffer, 1.8 mM EDTA 6 37Β°C 53 mM benzyloxycarbonyl-glutaminyl-glycine, 352 mM Hydroxylamine Glycine , Ξ³-glutamyl hydroxamate β€” β€” Classical aqueous control (in %), assay in the presence of organic solvent
β€Ή Prev
1 2 3 4 … 6

Mutations in this dataset (2)

WT S2P

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*