Esterase (gene estUT1) from Ureibacillus thermosphaericus UT1

Enzyme Description

Extremophile
Yes "thermophilic" organism
EC Number

Sequence

Length: 248 amino acids
MKIVSPKPFTIETGKRAVLLLHGFTGNTNDVKRLGRYLADRNYTVHAPLYKGHGSDPLTLINTDPIEWWNSAVEGYDELRRRGYKEIAVAGVSLGGIFSLRLGEERPIKAIVTMSAPALSKSVDSLQQRIISYTINYKKLTGTYNEDVDKPENLAKTYRMPKLEYLQGIINDTSAKLNQIDKPVHILRGLNDDEYYCQSADYIYNSVKSRIKSVKSFINSGHILTVDKERDLVFEEVYRFFESLKWEE
Yuliya V. Samoylova et al. (2018) β€” Cloning, expression and characterization of the esterase estUT1 from Ureibacillus thermosphaericus which belongs to a new lipase family XVIII
Extremophiles  Β· doi:10.1007/s00792-018-0996-9 β†—  Β· Stability - Incubation
36 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (36 measurements)

36 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100 36 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 30% 100 101 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 124 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 76 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 71 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10% 100 17 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100 142 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100 104 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 30% 100 86 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 10% 100 113 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 116 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 101 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 73 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 6 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 130 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 73 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 66 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 18 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100 65 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 130 % Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol Incubation: 8, Assay: 8 Incubation: 50Β°C, Assay: 50Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*