Esterase (gene EstSL3) from Alkalibacterium sp. SL3
Enzyme Description
Species
Extremophile
Yes
"halophilic", "alkalophilic" organism,"cold-adapted" enzyme
EC Number
Sequence
MKINKNDTLLFIGDSITDVGRDRMDGEDLGKGFPLMVASHLQSRYPAKRLTVLNRGIGGDSLKDLKRRWEDDCLITNPDIVTLLIGVNDTWRNQNDGVELTDEELDEFESDYRFLLKSLHQRTDARVILMESFVLPYPKRRVGWRNDLDKRIQIVRKMARDYQTELIPLDGLLNAAGIRDGFSYYTGDDGVHPTVAGHGLIANSWLKAVDE
Guozeng Wang et al. (2016)
β A novel cold-adapted and highly salt-tolerant esterase from Alkalibacterium sp. SL3 from the sediment of a soda lake
Scientific Reports
Β· doi:10.1038/srep19494 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A140IHU5 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (22 measurements)
22 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 20% | 100.0 | 7.3 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 20% | 100.0 | 74.2 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 10% | 100.0 | 92.7 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Chloroform | 20% | 100.0 | 45.6 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Chloroform | 10% | 100.0 | 57.1 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 20% | 100.0 | 81.9 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Glycerol | 10% | 100.0 | 77.5 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | n-Hexane | 20% | 100.0 | 89.1 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | n-Hexane | 10% | 100.0 | 98.1 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 20% | 100.0 | 24.4 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10% | 100.0 | 48.4 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10% | 100.0 | 75.8 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isoamyl Alcohol | 10% | 100.0 | 34.8 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isobutanol | 20% | 100.0 | 33.0 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isobutanol | 10% | 100.0 | 73.5 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 20% | 100.0 | 24.3 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 10% | 100.0 | 38.4 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 20% | 100.0 | 91.2 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Propanol | 10% | 100.0 | 97.9 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20% | 100.0 | 87.4 | % | 50 mM TrisβHCl buffer, 10% acetonitrile | 9 | 30Β°C | 1 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.