Esterase (gene est4) from a marine mud metagenomic library

Enzyme Description

Species
Na (marine mud metagenomic library)
Extremophile
No
EC Number

Sequence

Length: 316 amino acids
MLVLWLLFLFFMSMLGLVLFASFSNKKAEQFLPPAGQFAKLSQGTLHYLDEGQGPAVVLVHGLAGNFHNFTYGVSKPLSAQYRVIAVDRPGCGYSKRNPHADASLEAQADTLIELLDHLKIESAVFVGHSLGGAISLAAAQRHPSRIKALALIAPLTHQPESPAPVFKPLDIPSPVLRKLIGWTFAVPGTLLRMSTSLKFIFGPEKAPADFAIRGGGILALKPQTFITASSDLQQVKACMPNIEAAYASMTTPVHVLYGREDRILSAKLNGEDLAQRLPGTQLTLINGGHMLPVTQAEVTCQFIAGVAGKATGLAP
Wenyuan Gao et al. (2016) β€” A novel esterase from a marine mud metagenomic library for biocatalytic synthesis of short-chain flavor esters
Microbial Cell Factories  Β· doi:10.1186/s12934-016-0435-5 β†—  Β· Stability - Incubation
39 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (39 measurements)

39 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 100% 100.0 4.9 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Benzene 50% 100.0 76.1 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Toluene 50% 100.0 88.1 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Cyclohexane 50% 100.0 92.7 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 50% 100.0 95.3 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Heptane 50% 100.0 96.9 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isooctane 50% 100.0 90.0 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 100% 100.0 0.6 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 100% 100.0 5.8 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 100% 100.0 1.3 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 50% 100.0 0.0 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetone 100% 100.0 85.2 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 100% 100.0 89.0 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 100% 100.0 97.0 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Benzene 100% 100.0 92.8 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Toluene 100% 100.0 90.1 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Cyclohexane 100% 100.0 99.7 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 100% 100.0 98.6 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Heptane 100% 100.0 97.6 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
Stability - Incubation Activity after incubation (12 hours at 30Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isooctane 100% 100.0 98.4 % Incubation: 100 mM Tris-HCl buffer, Assay: 100 mM Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” Incubation: 200 rpm Water-incubated control (in %), assay measured in aqueous phase | Clear about assay in aqueous phase
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*