Esterase (gene Est1) from Psychrobacter pacificensis

Enzyme Description

Species
Psychrobacter pacificensis β†—
Extremophile
Yes "psychrophilic" organism
EC Number
3.1.1.1 β†—

Sequence

Length: 296 amino acids
MQNSYSHSLSNHKQLTQKSVNRCFNGEQHYYSHESTSTKTSMTFSIYLPDEALAGRRCPAILYLSGLTCNADNVTHKGHFQQKCSELGMILIAPDTSPRSSEDSDVPNDERYFVGQGASYYVDATQAPWSDNFNMQSYIVDELYDLLRSEFPIDSIGITGHSMGGHGALLLGFKFPSKFVSVSALSPVCAASESAWGQAAYTEYFGDDKSLWVQADAAQMIEKVGQQYASILVDQGAADNFLAEGQLQTSKLQDACAKAEQPLTLRYQAGHDHSYYFIQTVINDHIEHHWHMAQMS
Gaobing Wu et al. (2015) β€” A cold-adapted, solvent and salt tolerant esterase from marine bacterium Psychrobacter pacificensis
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2015.07.045 β†—  Β· Stability - Incubation
32 measurements ▼
Database ID
UniProt: A0A1G7A325 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (32 measurements)

32 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Propanediol 5% 100 117 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 30% 100 106 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 15% 100 123 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 10% 100 118 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Glycerol 5% 100 111 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 30% 100 46 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 15% 100 119 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 10% 100 119 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Acetonitrile 5% 100 120 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30% 100 204 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 15% 100 194 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10% 100 161 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 5% 100 137 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Propanediol 30% 100 243 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Propanediol 15% 100 170 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Propanediol 10% 100 144 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 5% 100 117 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 30% 100 14 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 15% 100 38 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10% 100 47 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*