Esterase (gene Est1) from Psychrobacter pacificensis

Enzyme Description

Extremophile
Yes "psychrophilic" organism
EC Number

Sequence

Length: 296 amino acids
MQNSYSHSLSNHKQLTQKSVNRCFNGEQHYYSHESTSTKTSMTFSIYLPDEALAGRRCPAILYLSGLTCNADNVTHKGHFQQKCSELGMILIAPDTSPRSSEDSDVPNDERYFVGQGASYYVDATQAPWSDNFNMQSYIVDELYDLLRSEFPIDSIGITGHSMGGHGALLLGFKFPSKFVSVSALSPVCAASESAWGQAAYTEYFGDDKSLWVQADAAQMIEKVGQQYASILVDQGAADNFLAEGQLQTSKLQDACAKAEQPLTLRYQAGHDHSYYFIQTVINDHIEHHWHMAQMS
Gaobing Wu et al. (2015) β€” A cold-adapted, solvent and salt tolerant esterase from marine bacterium Psychrobacter pacificensis
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2015.07.045 β†—  Β· Stability - Incubation
32 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (32 measurements)

32 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 5% 100 60 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethylene Glycol 30% 100 73 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethylene Glycol 15% 100 29 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethylene Glycol 10% 100 33 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethylene Glycol 5% 100 43 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 30% 100 112 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 15% 100 165 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10% 100 156 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 5% 100 137 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 30% 100 133 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 15% 100 157 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
Stability - Incubation Activity after incubation (1 hour at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10% 100 138 % ? Incubation, 20 mM Tris-HCl Incubation: ?, Assay: 7.5 Incubation: 4Β°C, Assay: 25Β°C 0.01 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase | Incorrect UniProt EC number
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*