Protease (gene STAP) from Streptomyces koyangensis TN650

Enzyme Description

Species
Streptomyces koyangensis TN650 β†—
Extremophile
No but "thermo-alkaline" enzyme
EC Number
3.4.- β†—

Sequence

Length: 388 amino acids
TQSNPPSWGLDRIDQTTAFTKACSIKYPLQGLQWDLPAIQADKAHEKSLGSRQVTVAVIDTGVDDTHPDIAPNFDRQASVNCVAGKPDTADGAWRPSAAESPHGTHVAGEIAAAKNGVGMTGVAPGVKVAGIKVSNPDGFFYTEAVVCGFMWAAEHGVDVTNNSYYTDPWYFNCATDPDQKALVEAVSRASRYAERRGAVNVAAAGNENYDLTSDEITDPSSPNDTTPGDRTVDPSKCLDIPTQLPGVVTVAATGAKGLKSSFSNHGLGVIDIAAPGGDSTAYQTPEPPATSGLILGTLPGGKWGYMAGTSMASPHVACVAALIKSTHPHAPAAMVKALLYAEADATACTKPYDIDGDGKYKAVCEGPKNRNGFYGWGMADALDAVTW
Mouna Ben Elhoul et al. (2015) β€” A novel detergent-stable solvent-tolerant serine thiol alkaline protease from Streptomyces koyangensis TN650
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2015.06.006 β†—  Β· Stability - Incubation
26 measurements ▼
Database ID
UniProt: A0A0G3ZAS8 β†—
Sequence Annotation
Explicit - Provided (124 first residues from UniProt sequence absent from the mature protein)
Protein Source
Purified, bacterium Streptomyces koyangensis TN650

Experimental Data (26 measurements)

26 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexadecane 50% 100 102 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 101 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethylformamide (DMF) 50% 100 166 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethanol 50% 100 60 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Acetonitrile 50% 100 105 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Isopropanol 50% 100 190 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethyl Acetate 50% 100 50 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Butanol 50% 100 103 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase 1-Hexanol 50% 100 79 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Chloroform 50% 100 150 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexane 50% 100 111 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Heptane 50% 100 125 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (180 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Decane 50% 100 80 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase n-Hexadecane 50% 100 111 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50% 100 115 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Dimethylformamide (DMF) 50% 100 198 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethanol 50% 100 85 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Acetonitrile 50% 100 126 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Isopropanol 50% 100 235 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase Ethyl Acetate 50% 100 75 % Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C 1% Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*