Protease (gene STAP) from Streptomyces koyangensis TN650

Enzyme Description

Species

Streptomyces koyangensis TN650 ↗

Extremophile

No but "thermo-alkaline" enzyme

EC Number

3.4.- ↗

Sequence

Length: 388 amino acids

TQSNPPSWGLDRIDQTTAFTKACSIKYPLQGLQWDLPAIQADKAHEKSLGSRQVTVAVIDTGVDDTHPDIAPNFDRQASVNCVAGKPDTADGAWRPSAAESPHGTHVAGEIAAAKNGVGMTGVAPGVKVAGIKVSNPDGFFYTEAVVCGFMWAAEHGVDVTNNSYYTDPWYFNCATDPDQKALVEAVSRASRYAERRGAVNVAAAGNENYDLTSDEITDPSSPNDTTPGDRTVDPSKCLDIPTQLPGVVTVAATGAKGLKSSFSNHGLGVIDIAAPGGDSTAYQTPEPPATSGLILGTLPGGKWGYMAGTSMASPHVACVAALIKSTHPHAPAAMVKALLYAEADATACTKPYDIDGDGKYKAVCEGPKNRNGFYGWGMADALDAVTW

Mouna Ben Elhoul et al. (2015) — A novel detergent-stable solvent-tolerant serine thiol alkaline protease from Streptomyces koyangensis TN650

International Journal of Biological Macromolecules · doi:10.1016/j.ijbiomac.2015.06.006 ↗ · Stability - Incubation

26 measurements ▼

Database ID

UniProt: A0A0G3ZAS8 ↗

Sequence Annotation

Explicit - Provided (124 first residues from UniProt sequence absent from the mature protein)

Protein Source

Purified, bacterium Streptomyces koyangensis TN650

Experimental Data (26 measurements)

26 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	1-Butanol	50%	100	110	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	1-Hexanol	50%	100	90	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	Chloroform	50%	100	180	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	n-Hexane	50%	100	125	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	n-Heptane	50%	100	150	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation	Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase	n-Decane	50%	100	95	%	Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2	Incubation: ?, Assay: 10	Incubation: 30°C, Assay: 60°C	1% Casein	free amino acids , Peptides	—	Incubation: 150 rpm	Non-incubated control (in %), assay in aqueous phase \| Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Activity after incubation (180 days at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase

n-Hexadecane

50%

100

102

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Dimethyl Sulfoxide (DMSO)

50%

100

101

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Dimethylformamide (DMF)

50%

100

166

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Ethanol

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Acetonitrile

50%

100

105

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Isopropanol

50%

100

190

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Ethyl Acetate

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

1-Butanol

50%

100

103

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

1-Hexanol

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Chloroform

50%

100

150

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Hexane

50%

100

111

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Heptane

50%

100

125

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Decane

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Activity after incubation (1 day at 30°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reagent and free tyrosines reaction product absorbance measurement, 660 nm) in aqueous phase

n-Hexadecane

50%

100

111

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Dimethyl Sulfoxide (DMSO)

50%

100

115

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Dimethylformamide (DMF)

50%

100

198

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Ethanol

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Acetonitrile

50%

100

126

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Isopropanol

50%

100

235

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Ethyl Acetate

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

1-Butanol

50%

100

110

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

1-Hexanol

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

Chloroform

50%

100

180

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Hexane

50%

100

125

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Heptane

50%

100

150

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

Stability - Incubation

n-Decane

50%

100

Incubation: ?, Assay: 100 mM glycine-NaOH buffer, 3 mM CaCl2

Incubation: ?, Assay: 10

Incubation: 30°C, Assay: 60°C

1% Casein

free amino acids, Peptides

—

Incubation: 150 rpm

Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*

Protease (gene STAP) from Streptomyces koyangensis TN650

Enzyme Description

Sequence

Experimental Data (26 measurements)

Visualization : Stability — Incubation

Structure

Loading…