Esterase (gene est10) from Psychrobacter pacificensis
Enzyme Description
Species
Extremophile
No
but "psychrotrophic" organism
EC Number
Sequence
MSNYLDAVVVEHNPSQKKIDRAVIWLHGLGASGHDFEPVVPQLGLADDMAVRFIFPHAPKRPVTVNGGMVMPAWYDIIEMSLERKVDVAQIEESAQQIQDLISREIERGVSPEHIVIAGFSQGGAVAYHVALGYPERLAGLMTLSTYLATNDNIEYSAANKDMPILIEHGTHDPVVPVILGEHAQQLLTSKGYNVEYHTYSMAHQVCMPQIQNIGKWLNTVLA
Guojie Wu et al. (2013)
β Characterization of a cold-adapted and salt-tolerant esterase from a psychrotrophic bacterium Psychrobacter pacificensis
Extremophiles
Β· doi:10.1007/s00792-013-0562-4 β
Β· Stability - Incubation
▼
Database ID
UniProt: L7XC53 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (27 measurements)
27 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20% | 100.0 | 89.6 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 30% | 100.0 | 92.7 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 30% | 100.0 | 87.3 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30% | 100.0 | 88.7 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 30% | 100.0 | 86.4 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 88.4 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30% | 100.0 | 6.0 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 30% | 100.0 | 0.0 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30% | 100.0 | 0.7 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 30% | 100.0 | 3.1 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 20% | 100.0 | 94.0 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Propanediol | 20% | 100.0 | 88.2 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 20% | 100.0 | 89.3 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethylene Glycol | 20% | 100.0 | 84.9 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 10% | 100.0 | 52.9 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 20% | 100.0 | 61.3 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 20% | 100.0 | 77.8 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 20% | 100.0 | 89.8 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | 1-Butanol | 20% | 100.0 | 31.1 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
| Stability - Incubation | Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Glycerol | 10% | 100.0 | 86.9 | % | Incubation: ?, Assay: Phosphate-citrate buffer | Incubation: ?, Assay: 7.5 | Incubation: Room temperture, Assay: 25Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), activity measured in aqueous phase | Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.