Esterase (gene est10) from Psychrobacter pacificensis

Enzyme Description

Species

Psychrobacter pacificensis ↗

Extremophile

No but "psychrotrophic" organism

EC Number

3.1.1.1 ↗

Sequence

Length: 223 amino acids

MSNYLDAVVVEHNPSQKKIDRAVIWLHGLGASGHDFEPVVPQLGLADDMAVRFIFPHAPKRPVTVNGGMVMPAWYDIIEMSLERKVDVAQIEESAQQIQDLISREIERGVSPEHIVIAGFSQGGAVAYHVALGYPERLAGLMTLSTYLATNDNIEYSAANKDMPILIEHGTHDPVVPVILGEHAQQLLTSKGYNVEYHTYSMAHQVCMPQIQNIGKWLNTVLA

Guojie Wu et al. (2013) — Characterization of a cold-adapted and salt-tolerant esterase from a psychrotrophic bacterium Psychrobacter pacificensis

Extremophiles · doi:10.1007/s00792-013-0562-4 ↗ · Stability - Incubation

27 measurements ▼

Database ID

UniProt: L7XC53 ↗

Sequence Annotation

Explicit - Provided

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (27 measurements)

27 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Propanediol	10%	100.0	93.1	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	93.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethylene Glycol	10%	100.0	100.2	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	108.4	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	10%	100.0	107.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	93.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	10%	100.0	97.6	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid , p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	20%	100.0	89.6	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Glycerol	30%	100.0	92.7	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Propanediol	30%	100.0	87.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	30%	100.0	88.7	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethylene Glycol	30%	100.0	86.4	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100.0	88.4	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	30%	100.0	6.0	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	30%	100.0	0.0	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	30%	100.0	0.7	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	30%	100.0	3.1	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Glycerol	20%	100.0	94.0	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Propanediol	20%	100.0	88.2	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	20%	100.0	89.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethylene Glycol	20%	100.0	84.9	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	10%	100.0	52.9	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	20%	100.0	61.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	20%	100.0	77.8	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	20%	100.0	89.8	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	1-Butanol	20%	100.0	31.1	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Glycerol	10%	100.0	86.9	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Propanediol	10%	100.0	93.1	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Methanol	10%	100.0	93.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethylene Glycol	10%	100.0	100.2	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Dimethyl Sulfoxide (DMSO)	10%	100.0	108.4	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Acetonitrile	10%	100.0	107.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Isopropanol	10%	100.0	93.3	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase
Stability - Incubation	Activity after incubation (1 hour at room temperature), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase	Ethanol	10%	100.0	97.6	%	Incubation: ?, Assay: Phosphate-citrate buffer	Incubation: ?, Assay: 7.5	Incubation: Room temperture, Assay: 25°C	1 mM p-Nitrophenyl butyrate	Butyric Acid, p-Nitrophenol	—	—	Non-incubated control (in %), activity measured in aqueous phase \| Uncertainty about whether assay was in the presence of organic solvent or in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*