Esterase (gene RBest1) from a forest soil metagenomic library
Enzyme Description
Sequence
MSHLKTLSAFVVAAAAFGLGMPAQAAETLVEENVSYAKLDGTDLKLDIARPDGDGPYPAIVFIHGGGWYQGSRQRYRETIREAARRGYVGITITYRLMKFDEAKKETTKATPNFPAQIQDAKAALRWVRANSKKYHIDADHIGVTGESAGGHLSLPVGLKDAKAGLEGDAGNAEQSSRVQAVVNVFGPTDMEQCFKTSSVAWIFRLFMGGTPEEAAETYRVASPITYVSSDDPPVLTIHGDKDALVPIAQATMLDDKMKSAGAKHTLLLLKGQGHGFAGQAQQFCE
Renaud Berlemont et al. (2013)
β Novel organic solvent-tolerant esterase isolated by metagenomics: insights into the lipase/esterase classification
Revista Argentina de MicrobiologΓa
Β· PMID: 23560782 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0001818360 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli RR1
Experimental Data (29 measurements)
29 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | n-Pentane | 25% | 100.0 | 501.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (2 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | p-Xylene | 25% | 100.0 | 167.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (2 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Benzene | 25% | 100.0 | 201.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (2 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Acetonitrile | 25% | 100.0 | 0.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (2 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Dimethylformamide (DMF) | 25% | 100.0 | 20.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (2 hours at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25% | 100.0 | 116.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | n-Hexane | 25% | 0.59 | 0.8 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | n-Pentane | 25% | 0.59 | 1.2 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | p-Xylene | 25% | 0.59 | 1.7 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Toluene | 25% | 0.59 | 1.3 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Benzene | 25% | 0.59 | 2.1 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Acetonitrile | 25% | 0.59 | 0.2 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Dimethylformamide (DMF) | 25% | 0.59 | 0.7 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25% | 0.59 | 0.7 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl caprylate | Caprylic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | n-Hexane | 25% | 100.0 | 39.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25% | 9.0 | 33.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenol acetate | Acetic Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | p-Xylene | 25% | 100.0 | 572.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Toluene | 25% | 100.0 | 535.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Benzene | 25% | 100.0 | 848.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
| Stability - Incubation | Activity after incubation (30 minutes at 40Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurment) in aqueous phase | Acetonitrile | 25% | 100.0 | 0.0 | % | Incubation: 20 mM Tris-HCl, Assay: 20 mM Tris-HCl | Incubation: 8, Assay: 8 | Incubation: 40Β°C, Assay: 40Β°C | 1.25 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | Yes incubation with "Rotational agitation" | Water-incubated control (in %), assay in aqueous phase | Activity with p-Nitrophenyl butyrate as 100% |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.