Esterase (gene EstA) with mesophilic expression from Sulfolobus islandicus
Enzyme Description
Sequence
MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGKVEDIKIPGSEANINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALLSKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPILAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIEQGRDAISLIGSVLRRTFYDKS
Yuxia Mei et al. (2011)
β Exceptional thermal stability and organic solvent tolerance of an esterase expressed from a thermophilic host
Applied Microbiology and Biotechnology
Β· doi:10.1007/s00253-011-3504-z β
Β· Stability - Incubation
▼
Database ID
UniProt: F0NDQ1 β
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (22 measurements)
22 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 60% | 100.0 | 12.3 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Chloroform | 60% | 100.0 | 0.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Chloroform | 30% | 100.0 | 0.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Hexane | 60% | 100.0 | 0.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | n-Hexane | 30% | 100.0 | 10.2 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Isoamyl Alcohol | 60% | 100.0 | 0.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Isoamyl Alcohol | 30% | 100.0 | 7.9 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | 1-Butanol | 60% | 100.0 | 6.4 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | 1-Butanol | 30% | 100.0 | 17.9 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetonitrile | 60% | 100.0 | 4.3 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetonitrile | 30% | 100.0 | 39.7 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Methanol | 30% | 100.0 | 61.3 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 30% | 100.0 | 73.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Isopropanol | 60% | 100.0 | 19.1 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Isopropanol | 30% | 100.0 | 30.2 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | 1-Propanol | 60% | 100.0 | 9.2 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | 1-Propanol | 30% | 100.0 | 31.6 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetone | 60% | 100.0 | 13.7 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Acetone | 30% | 100.0 | 63.0 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
| Stability - Incubation | Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase | Ethanol | 60% | 100.0 | 17.5 | % | Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) | Incubation: 7, Assay: 8 | Incubation: 70Β°C, Assay: 65Β°C | 8 mM p-Nitrophenyl hexanoate | Hexanoic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.