Esterase (gene EstA) with mesophilic expression from Sulfolobus islandicus

Enzyme Description

Species

Sulfolobus islandicus ↗

Extremophile

Yes thermophilic organism

EC Number

3.1.1.1 ↗

Sequence

Length: 305 amino acids

MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGKVEDIKIPGSEANINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALLSKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPILAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIEQGRDAISLIGSVLRRTFYDKS

Yuxia Mei et al. (2011) — Exceptional thermal stability and organic solvent tolerance of an esterase expressed from a thermophilic host

Applied Microbiology and Biotechnology · doi:10.1007/s00253-011-3504-z ↗ · Stability - Incubation

22 measurements ▼

Database ID

UniProt: F0NDQ1 ↗

Sequence Annotation

Inferred - from protein name

Protein Source

Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements — page 2 of 2

Property	Assay	Solvent	Solvent Volume	Aqueous Reference	Measured Value	Units	Solution	pH	Temperature	Substrate(s)	Product(s)	Cofactor(s)	Shaking	Comments
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	30%	100.0	41.4	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Methanol	60%	100.0	23.1	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid , p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase

Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethyl Sulfoxide (DMSO)	60%	100.0	12.3	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Chloroform	60%	100.0	0.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Chloroform	30%	100.0	0.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	n-Hexane	60%	100.0	0.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	n-Hexane	30%	100.0	10.2	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isoamyl Alcohol	60%	100.0	0.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isoamyl Alcohol	30%	100.0	7.9	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Butanol	60%	100.0	6.4	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Butanol	30%	100.0	17.9	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetonitrile	60%	100.0	4.3	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetonitrile	30%	100.0	39.7	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Methanol	30%	100.0	61.3	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Dimethyl Sulfoxide (DMSO)	30%	100.0	73.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isopropanol	60%	100.0	19.1	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Isopropanol	30%	100.0	30.2	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Propanol	60%	100.0	9.2	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	1-Propanol	30%	100.0	31.6	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetone	60%	100.0	13.7	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Acetone	30%	100.0	63.0	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	60%	100.0	17.5	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Ethanol	30%	100.0	41.4	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase
Stability - Incubation	Activity after incubation (30 minutes at 70°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase	Methanol	60%	100.0	23.1	%	Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference)	Incubation: 7, Assay: 8	Incubation: 70°C, Assay: 65°C	8 mM p-Nitrophenyl hexanoate	Hexanoic Acid, p-Nitrophenol	—	—	Non-incubated control (in %), residual activity measured in aqueous phase \| Uncertainty about whether assay was really in aqueous phase

‹ Prev

1 2

Next ›

Visualization : Stability — Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate · Scroll to zoom · Right-click drag to pan · Powered by Mol*